Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_900129945.1: Butyrivibrio fibrisolvens, DSM 3071 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_073388448.1:DEOLOIKH_01415
Genome uid: 32
69431-69991 [+] (186)

Sequence:

SDNTNKSSSENQKTMELRELVKLPENEQYLFLLNSVPNDEERIRIGLVLDYYIKNANKNRKYHRWFSALGVIIPALATFV
SVFSGAENFPWFSRYMVPFMTAITSIVVGISSTLKFTDKHRTYRNCAESIKHILLGYACGQGDFADMDKEEKETLLYDQT
EKIIQEGSKELGKIDKGLVSRDEVS

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	65			1057116	106468	18	136:Membrane Protein	15	0	1	2564	0	1
2	DeepTMHMM:inside		inside	1	66			1095653	106468	9730	15	0	1	2564	0	2
3	PFAM:PF14015	IPR025325	Protein of unknown function (DUF4231)	49	152	42.7	6.3E-11	1057115	106468	4891	15	0	1	2564	0	3
4	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	65	84			1057119	106468	5	136:Membrane Protein	15	0	1	2564	0	4
5	DeepTMHMM:TMhelix		TMhelix	67	84			1095654	106468	2056	141:DeepTMHMM: helix	15	0	1	2564	5	5
6	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	84	95			1057120	106468	3	136:Membrane Protein	15	0	1	2564	0	6
7	DeepTMHMM:outside		outside	85	92			1095655	106468	10025	15	0	1	2564	0	7
8	DeepTMHMM:TMhelix		TMhelix	93	111			1095656	106468	2056	141:DeepTMHMM: helix	15	0	1	2564	5	8
9	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	95	115			1057118	106468	5	136:Membrane Protein	15	0	1	2564	0	9
10	DeepTMHMM:inside		inside	112	186			1095657	106468	9730	15	0	1	2564	0	10
11	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	115	186			1057117	106468	18	136:Membrane Protein	15	0	1	2564	0	11

↑ Top