Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000571935.1: Ruminococcus flavefaciens, 007c [+] (ncbi)

Genbanks info:

Genbank_acc: WP_019680487.1:NHIAMGPD_03071
Genome uid: 28
172464-173138 [+] (224)

Sequence:

GNSEYRKTIDYILDLIRGGMLRVGDKLPTERSISEKLGISRNTVREALRGLEILGIVNGKQGSGNYLTDNISESIAKAMD
IMLLMNRTSKEEICSFRRSMEKTVCSYLIARGCSSENKLKIVAALNRLKESEGTGDRTIADRDFHYSLIYATENSFWITF
MEAVSEVYMRWIDDFLMTADSSVRAALQDAHEKMVQGIITGDVDFCFKAIDAHYDMIDKSFEN

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	2	71			883707	126496	323	0	0	1	2504	0	1
2	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	5	67	61.3	5.0E-17	883705	126496	322	0	0	1	2504	0	2
3	CDD:cd07377	IPR000524	WHTH_GntR	5	69			883708	126496	324	0	0	1	2504	0	3
4	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	5	70			883710	126496	42	0	0	1	2504	0	4
5	SMART:SM00345	IPR000524		8	68			883704	126496	1	0	0	1	2504	0	5
6	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	27	42			883703	126496	2145	0	0	1	2504	0	6
7	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	41	58			883702	126496	2145	0	0	1	2504	0	7
8	SUPERFAMILY:SSF48008	IPR008920	Transcription regulator FadR/GntR, C-terminal	91	217			883709	126496	325	0	0	1	2504	0	8
9	PFAM:PF07729	IPR011711	FCD domain	92	216	41.5	1.6E-10	883706	126496	316	0	0	1	2504	0	9

↑ Top