Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch1_genome_fasta/FD_SO4_25_1_F22: FD_SO4_25_1_F22, AnGL30 [-] (ncbi)

Genbanks info:

Genbank_acc: AnGL30_00615
Genome uid: 360
774189-775505 [+] (438)

Sequence:

GNLVAIVGRPNVGKSTLFNRLTKTRQAIVSSEAGTTRDRQYGKIEWGGREFSIVDTGGWVINSDDIFEEEIRKQVVLAVE
EADVIVFVVDVLTGVTDLDLAVSSVLRDTKKPVLLVSNKTDTHDLRYDSAEFYKLGLNADPMCVSAVTGTGTGDLLDSIV
GSFSKESAEIIDEDVPRFAVVGRPNAGKSSIVNAFIGEERNIVTDIAGTTRDSIYTRYNKFNFDFYLVDTAGIRKKNKVN
EDLEYYSVIRSIGAIENSDVCILMLDATRGIESQDLNIFSLIQRNNKGLVVVVNKWDLVEDKTAKLMNHFTSVVKERFAP
FNDFPIIFTSVITKQRILKVLESAREVFKNRSTRIPTAQLNHEMLSLIEAYPPPANKGKYIKIKYITQLPNTSIPSFVFF
ANLPQYVREPYKRFLENKMREKWDLSGTPIKLYIRQK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PROSITE_PROFILES:PS51712	IPR031166	EngA-type guanine nucleotide-binding (G) domain profile.	2	168			2472477	1533980	2474	0	0	0	593	0	1
2	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	4	25			2472473	1533980	495	0	0	0	593	0	2
3	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	4	120	100.3	6.6E-29	2472476	1533980	496	0	0	0	593	0	3
4	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	4	165			2472481	1533980	78	0	0	0	593	0	4
5	CDD:cd01894		EngA1	5	164			2472480	1533980	2476	0	0	0	593	0	5
6	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	72	91			2472472	1533980	495	0	0	0	593	0	6
7	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	140	437			2472482	1533980	78	0	0	0	593	0	7
8	CDD:cd01895		EngA2	174	349			2472479	1533980	2475	0	0	0	593	0	8
9	PROSITE_PROFILES:PS51712	IPR031166	EngA-type guanine nucleotide-binding (G) domain profile.	176	353			2472478	1533980	2474	0	0	0	593	0	9
10	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	178	296	80.3	1.1E-22	2472475	1533980	496	0	0	0	593	0	10
11	PFAM:PF14714	IPR032859	KH-domain-like of EngA bacterial GTPase enzymes, C-terminal	354	436	93.9	5.4E-27	2472474	1533980	2473	0	0	0	593	0	11

↑ Top