Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch1_genome_fasta/FD_YE_37_3: FD_YE_37_3, AnGL26 [-] (ncbi)

Genbanks info:

Genbank_acc: AnGL26_03003
Genome uid: 363
3697106-3698206 [+] (366)

Sequence:

ALKCGIVGLPNVGKSTLFNCLSNAKAQSANFPFCTIEPNVGVITVPDDRLIKLEELVHPERVLPTTVEIVDIAGLVRGAS
KGEGLGNKFLGNIRETDAIIHVLRCFENENITHVDTTIDPVRDKETIDIELQLKDLETVESRIAKVEKQARTGNDPEAKR
LFKVLSLYKDVLLQGKSARTVELDDTDLKVAKDLQLLTNKPILYICNVDEPSVVKGNAHVEALKEAIKDENAEMLMIAAA
TEADIAELDDFEERQMFLEDLGLKESGVNKLIKSAYKLLELETYFTAGVKEVRAWTYKKGFKAPQAAGVIHSDFEKGFIR
AEVIKYNDFVTLGSEQACKEAGKMAIEGKEYIVQDGDIMHFRFNV

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PROSITE_PROFILES:PS51710	IPR031167	OBG-type guanine nucleotide-binding (G) domain profile.	2	281			2627430	1552716	1908	0	0	0	2948	0	1
2	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	2	304			2627434	1552716	78	0	0	0	2948	0	2
3	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	4	25			2627425	1552716	495	0	0	0	2948	0	3
4	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	4	125	83.6	1.0E-23	2627428	1552716	496	0	0	0	2948	0	4
5	CDD:cd01900	IPR041706	YchF	4	280			2627433	1552716	3406	0	0	0	2948	0	5
6	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	25	44			2627424	1552716	495	0	0	0	2948	0	6
7	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	69	85			2627427	1552716	495	0	0	0	2948	0	7
8	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	86	105			2627426	1552716	495	0	0	0	2948	0	8
9	CDD:cd04867	IPR013029	TGS_YchF_OLA1	279	364			2627432	1552716	3405	0	0	0	2948	0	9
10	PROSITE_PROFILES:PS51880	IPR004095	TGS domain profile.	280	364			2627431	1552716	383	0	0	0	2948	0	10
11	PFAM:PF06071	IPR013029	Protein of unknown function (DUF933)	281	365	138	8.99998E-41	2627429	1552716	3404	0	0	0	2948	0	11
12	SUPERFAMILY:SSF81271	IPR012676	TGS-like	281	363			2627435	1552716	389	0	0	0	2948	0	12

↑ Top