Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch2_genome_fasta/FD-LS-11-2: Paraclostridium benzoelyticum, AnGL27 [+] (ncbi)

Genbanks info:

Genbank_acc: AnGL27_01178
Genome uid: 374
735393-736478 [+] (361)

Sequence:

DSERKIIHIDMDAFYASVEQRDNPRLKGKPVIVGGSPEGRGVVATCSYEARIFGIHSAMPSSVAYVRCPHAVFVPTRFEV
YQKISYQIREIFKRYTDIIEPLSLDEAYLDVTTNKKGVKYATTIAKQIKEDIKNEIGITASAGVSYNKFLAKIASDYKKP
NGLTVITPDKAQEFIDNLPINKFFGIGKVTSKTLKIMGIKKGYDLRNMNLIELEQIFKKKGYDMYNFARGIDHRPVQVSR
ERKSVGAESTFISNVYFDSDELNEHIKDVVKDVCKRLEYTNKCGKTITIKIKYADFKQVTKRRTLESPIYTYDDILKNTN
ILIEKVKNKERQIRLIGVTMSNLIDCKKEEYNNISLFDKL

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF56672	IPR043502	DNA/RNA polymerase superfamily	2	237			3165990	1604070	1847	0	0	0	1064	0	1
2	PROSITE_PROFILES:PS50173	IPR001126	UmuC domain profile.	6	188			3165987	1604070	3106	0	0	0	1064	0	2
3	CDD:cd03586	IPR022880	PolY_Pol_IV_kappa	7	344			3165988	1604070	3107	0	0	0	1064	0	3
4	PFAM:PF00817	IPR001126	impB/mucB/samB family	9	157	164.7	0	3165985	1604070	3105	0	0	0	1064	0	4
5	PFAM:PF11798	IPR024728	IMS family HHH motif	168	200	30.9	2.0E-7	3165984	1604070	3717	0	0	0	1064	0	5
6	SUPERFAMILY:SSF100879	IPR036775	DNA polymerase, Y-family, little finger domain superfamily	240	343			3165989	1604070	3108	0	0	0	1064	0	6
7	PFAM:PF11799	IPR017961	impB/mucB/samB family C-terminal domain	242	351	62.5	4.6E-17	3165986	1604070	3104	0	0	0	1064	0	7

↑ Top