Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch2_genome_fasta/V.boronicumulans: Variovorax sp., EBFNA2 [-] (ncbi)

Genbanks info:

Genbank_acc: PaGL#33_05902
Genome uid: 380
6293392-6294162 [+] (256)

Sequence:

EQPVLLFGWFRWDILVEYKDLFWQGAWMTLRMTVVCVLLGASWGLCLALARLAQARHAPWTWLTRVFLRWPATVYVSFFR
GTPLFVQILLIHFAVMPVFIHPSTGLLIDGDLARTLKQEHGALISGVVALTLNSAAYISEVFRAGIQSISRGQFDAGRSL
GFSPAQVMRYVVLPQAFRRMLPPLGNNAIALLKDTSLVSAIGLAELAYAARTVAGAYARYWEPYLAISVVYWVMTLVLTT
LLRRLEHRLARSDRG

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	28			3600429	1642432	3	136:Membrane Protein	0	0	0	6664	0	1
2	DeepTMHMM:outside		outside	1	25			3637452	1642432	10025	0	0	0	6664	0	2
3	SUPERFAMILY:SSF161098	IPR035906	MetI-like superfamily	20	236			3600433	1642432	225	0	0	0	6664	0	3
4	DeepTMHMM:TMhelix		TMhelix	26	51			3637453	1642432	2056	141:DeepTMHMM: helix	0	0	0	6664	6	4
5	PROSITE_PROFILES:PS50928	IPR000515	ABC transporter integral membrane type-1 domain profile.	26	243			3600431	1642432	223	136:Membrane Protein	0	0	0	6664	0	5
6	CDD:cd06261	IPR000515	TM_PBP2	26	235			3600432	1642432	224	0	0	0	6664	0	6
7	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	28	51			3600421	1642432	5	136:Membrane Protein	0	0	0	6664	0	7
8	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	51	62			3600426	1642432	18	136:Membrane Protein	0	0	0	6664	0	8
9	DeepTMHMM:inside		inside	52	71			3637454	1642432	9730	0	0	0	6664	0	9
10	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	62	79			3600422	1642432	5	136:Membrane Protein	0	0	0	6664	0	10
11	PFAM:PF00528	IPR000515	Binding-protein-dependent transport system inner membrane component	67	251	69.1	4.0E-19	3600419	1642432	220	136:Membrane Protein	0	0	0	6664	0	11
12	DeepTMHMM:TMhelix		TMhelix	72	96			3637455	1642432	2056	141:DeepTMHMM: helix	0	0	0	6664	6	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	79	84			3600430	1642432	3	136:Membrane Protein	0	0	0	6664	0	13
14	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	84	109			3600420	1642432	5	136:Membrane Protein	0	0	0	6664	0	14
15	DeepTMHMM:outside		outside	97	123			3637456	1642432	10025	0	0	0	6664	0	15
16	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	109	120			3600425	1642432	18	136:Membrane Protein	0	0	0	6664	0	16
17	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	120	139			3600424	1642432	5	136:Membrane Protein	0	0	0	6664	0	17
18	DeepTMHMM:TMhelix		TMhelix	124	139			3637457	1642432	2056	141:DeepTMHMM: helix	0	0	0	6664	6	18
19	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	139	224			3600428	1642432	3	136:Membrane Protein	0	0	0	6664	0	19
20	DeepTMHMM:inside		inside	140	181			3637458	1642432	9730	0	0	0	6664	0	20
21	DeepTMHMM:TMhelix		TMhelix	182	193			3637459	1642432	2056	141:DeepTMHMM: helix	0	0	0	6664	6	21
22	DeepTMHMM:outside		outside	194	221			3637460	1642432	10025	0	0	0	6664	0	22
23	DeepTMHMM:TMhelix		TMhelix	222	243			3637461	1642432	2056	141:DeepTMHMM: helix	0	0	0	6664	6	23
24	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	224	243			3600423	1642432	5	136:Membrane Protein	0	0	0	6664	0	24
25	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	243	256			3600427	1642432	18	136:Membrane Protein	0	0	0	6664	0	25
26	DeepTMHMM:inside		inside	244	256			3637462	1642432	9730	0	0	0	6664	0	26

↑ Top