We will take the links to it out when ready.
Batch2_genome_fasta/V.paradoxus: Variovorax paradoxus, 2u118 [-] (ncbi)
DLNRQPGVALHHQITTMIEDMVASGRLRDGDQLPTEEDLRAQYGVSRVTVRRALQSLEARGLLKRQRGRGTYLSVPFASA PLPMPMNAFLEAMAERRSRSTPSVKEFGFVPAPLDVATALQIEEGTVVLKVVRVRVTGRTPILHSVAYLTEDVGRRFAKA DFGRAALTELLQAEGIRYDRIEMVTRATLADVSLAKLLDVAIGSALVDVMRIGYDKKGRPFEFQILRGPSDRFHTHVTIR G
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 3 | 77 | 3716549 | 1644398 | 42 | 0 | 0 | 0 | 439 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 8 | 77 | 3716547 | 1644398 | 323 | 0 | 0 | 0 | 439 | 0 | 2 | |||
| 3 | CDD:cd07377 | IPR000524 | WHTH_GntR | 10 | 75 | 3716548 | 1644398 | 324 | 0 | 0 | 0 | 439 | 0 | 3 | |||
| 4 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 12 | 73 | 74.4 | 4.2E-21 | 3716545 | 1644398 | 322 | 0 | 0 | 0 | 439 | 0 | 4 | |
| 5 | SMART:SM00345 | IPR000524 | 14 | 74 | 3716543 | 1644398 | 1 | 0 | 0 | 0 | 439 | 0 | 5 | ||||
| 6 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 33 | 48 | 3716541 | 1644398 | 2145 | 0 | 0 | 0 | 439 | 0 | 6 | |||
| 7 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 47 | 64 | 3716542 | 1644398 | 2145 | 0 | 0 | 0 | 439 | 0 | 7 | |||
| 8 | SUPERFAMILY:SSF64288 | IPR028978 | Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily | 61 | 240 | 3716550 | 1644398 | 2147 | 0 | 0 | 0 | 439 | 0 | 8 | |||
| 9 | SMART:SM00866 | IPR011663 | 95 | 235 | 3716544 | 1644398 | 1 | 0 | 0 | 0 | 439 | 0 | 9 | ||||
| 10 | PFAM:PF07702 | IPR011663 | UTRA domain | 104 | 235 | 87 | 1.0E-24 | 3716546 | 1644398 | 2146 | 0 | 0 | 0 | 439 | 0 | 10 |