Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch3_genome_fasta/FD-SO4-25-14: Maridesulfovibrio salexigens, AnGL23 [-] (ncbi)

Genbanks info:

Genbank_acc: AnGL23_03230
Genome uid: 385
3524987-3525958 [+] (323)

Sequence:

IKAEECKRDIEVSIVTPMHNEEGCVREFHKRITAALQGMNTTYEILLVNDGSTDSTESIIRELAADDPNLKGVMLARNRG
QCTAIYAGIQESKGCYVVIMDGDLQHKPEEVPSLIEEIRKGYDLVSGCRTNRGESMIKRKLPSKIANYLMRATSGCQVKD
MGGLSVLKGKLARSMTLREGQHRLIPALVYGMGGSTSEVPISAPPRFAGESHYGLSRSIDVLFDIVMLWFQSSFKQRPIY
LFGRISLLMFMLASLVMVWLLYEKVFFGVHMGTRPPFMGCILLYLSSLGFMSTGFILESLANTYDAVMGTKTYQIREVVE
KE

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	239			3827727	1659387	18	136:Membrane Protein	0	0	0	3142	0	1
2	DeepTMHMM:inside		inside	1	241			3837001	1659387	9730	0	0	0	3142	0	2
3	SUPERFAMILY:SSF53448	IPR029044	Nucleotide-diphospho-sugar transferases	11	268			3827729	1659387	753	0	0	0	3142	0	3
4	PFAM:PF00535	IPR001173	Glycosyl transferase family 2	13	145	100.6	7.9E-29	3827722	1659387	751	0	0	0	3142	0	4
5	CDD:cd04187		DPM1_like_bac	14	194			3827728	1659387	1152	0	0	0	3142	0	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	239	262			3827724	1659387	5	136:Membrane Protein	0	0	0	3142	0	6
7	DeepTMHMM:TMhelix		TMhelix	242	262			3837002	1659387	2056	141:DeepTMHMM: helix	0	0	0	3142	6	7
8	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	262	281			3827723	1659387	3	136:Membrane Protein	0	0	0	3142	0	8
9	DeepTMHMM:outside		outside	263	277			3837003	1659387	10025	0	0	0	3142	0	9
10	DeepTMHMM:TMhelix		TMhelix	278	298			3837004	1659387	2056	141:DeepTMHMM: helix	0	0	0	3142	6	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	281	302			3827725	1659387	5	136:Membrane Protein	0	0	0	3142	0	11
12	DeepTMHMM:inside		inside	299	323			3837005	1659387	9730	0	0	0	3142	0	12
13	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	302	323			3827726	1659387	18	136:Membrane Protein	0	0	0	3142	0	13

↑ Top