Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2014: Geodermatophilus sp., RDM14 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#36_00805
Genome uid: 393
816729-818525 [+] (598)

Sequence:

SDRHILTAVAWPYANGPRHIGHVSGFGVPSDVFSRYHRMVGDRVLMVSGTDEHGTPITVAADAEGVTPREIADRNNRVIV
DDLAALGLSYDLFTRTTTVNHATISQEIFLGLLKNGYVFPQTTLGAISPSTGRTLPDRYIEGTCPICGYDGARGDQCDNC
GNQLDPVDLINPRSRINGETPKFVEEEHYFLDLPAFTKALGDWLATRKSWRPNVLNFSVNLLDDLKPRSYTRDIDWGVPV
PLDGWRDRPDKRIYVWFDAVVGYLSASIEWARRSGDPEAWRQWWQTPDSDAYYFMGKDNIVFHSEIWPAQLLGYDGEGDK
GGTPGSLGRLNLPTEVVSSEFLTMEGRKFSSSRNVVIYVRDFLARYDADALRYFIAVAGPENQDTDFTWAEFLRRNNDEL
VAGWGNLVNRTVSMAAKNVGAVPTPGELTDHDRALLATTSGAFAPVGDLLSRNRQKAAISEAMRVVGEANKYLSDQAPWK
LKEDPARRDTVLHTALQAIKDCNALLTPFLPQSAQKVHELLGGTGVWSAQPQVVEVTDLDDGSPYPVITGPYDEQQAGWT
STPLAPSGTPLAPPTPLFRKLDDSIVEEELRRLEDGE

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	CDD:cd00814	IPR033911	MetRS_core	3	388			4171113	1685701	1805	0	0	0	789	0	1
2	SUPERFAMILY:SSF52374		-	3	402			4171116	1685701	12	0	0	0	789	0	2
3	PFAM:PF09334	IPR015413	tRNA synthetases class I (M)	6	412	474.5	0	4171112	1685701	1798	0	0	0	789	0	3
4	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	7	21			4171106	1685701	1797	0	0	0	789	0	4
5	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	40	55			4171109	1685701	1797	0	0	0	789	0	5
6	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	88	100			4171108	1685701	1797	0	0	0	789	0	6
7	SUPERFAMILY:SSF57770	IPR029038	Methionyl-tRNA synthetase, Zn-domain	140	175			4171117	1685701	5913	0	0	0	789	0	7
8	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	253	265			4171110	1685701	1797	0	0	0	789	0	8
9	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	293	309			4171107	1685701	1797	0	0	0	789	0	9
10	CDD:cd07957	IPR041872	Anticodon_Ia_Met	396	522			4171114	1685701	1807	0	0	0	789	0	10
11	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	399	411			4171105	1685701	1797	0	0	0	789	0	11
12	SUPERFAMILY:SSF47323	IPR009080	Aminoacyl-tRNA synthetase, class Ia, anticodon-binding	404	594			4171115	1685701	726	0	0	0	789	0	12
13	PFAM:PF19303	IPR041872	Anticodon binding domain of methionyl tRNA ligase	422	543	34.5	1.6E-8	4171111	1685701	1803	0	0	0	789	0	13

↑ Top