We will take the links to it out when ready.
Batch4_genome_fasta/bc2034: Peribacillus frigoritolerans, 30N-5 [+] (ncbi)
QLEKLVAFHKTIGDVTRIRIISILANGPKHGQALAGILKLTAPTISHHLSKLKDINLVKDRREKNTVYYFLNEDVLQHYS TALPKMVSTKGDSSKMENQKLILEHKKILENFYTPDGRLKTIPAQRKKKMIVLHHIGSLLEKGRKYPEKELNEFIQSFHD DYATIRRELIIGSIMYRENSIYELNPREMWADII
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | PROSITE_PROFILES:PS50987 | IPR001845 | ArsR-type HTH domain profile. | 0 | 95 | 4527388 | 1728504 | 2465 | 0 | 0 | 0 | 2639 | 0 | 1 | |||
| 2 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 0 | 89 | 4527390 | 1728504 | 42 | 0 | 0 | 0 | 2639 | 0 | 2 | |||
| 3 | SMART:SM00418 | IPR001845 | 7 | 85 | 4527385 | 1728504 | 1 | 0 | 0 | 0 | 2639 | 0 | 3 | ||||
| 4 | PRINTS:PR00778 | IPR001845 | Bacterial regulatory protein ArsR family signature | 9 | 25 | 4527384 | 1728504 | 2463 | 0 | 0 | 0 | 2639 | 0 | 4 | |||
| 5 | CDD:cd00090 | IPR011991 | HTH_ARSR | 10 | 75 | 4527389 | 1728504 | 2346 | 0 | 0 | 0 | 2639 | 0 | 5 | |||
| 6 | PFAM:PF01022 | IPR001845 | Bacterial regulatory protein, arsR family | 14 | 60 | 41.2 | 1.1E-10 | 4527387 | 1728504 | 2464 | 0 | 0 | 0 | 2639 | 0 | 6 | |
| 7 | PRINTS:PR00778 | IPR001845 | Bacterial regulatory protein ArsR family signature | 41 | 57 | 4527383 | 1728504 | 2463 | 0 | 0 | 0 | 2639 | 0 | 7 | |||
| 8 | PRINTS:PR00778 | IPR001845 | Bacterial regulatory protein ArsR family signature | 56 | 72 | 4527382 | 1728504 | 2463 | 0 | 0 | 0 | 2639 | 0 | 8 | |||
| 9 | PFAM:PF09860 | IPR018656 | Uncharacterized protein conserved in bacteria (DUF2087) | 118 | 184 | 77.5 | 6.5E-22 | 4527386 | 1728504 | 3825 | 0 | 0 | 0 | 2639 | 0 | 9 |