Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2035: Micromonospora inositola, Utrum1 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#61_00864
Genome uid: 401
856834-857724 [+] (296)

Sequence:

ALDARGGRSRRDVSRPGLVRRPRAGGPAGTADQDQPAPLEEPTTMRLDGRVALVTGAGSPDGIGYATARRLADLGARVAI
VSTTRRIHDRAGELGVTGFVADLTDESEVGALADAVAEQLGDVEVLVNNAGLASRASPEVLRPVAQLTYDEWRGEIDRNL
TTAFLCSRAFISGMAERGWGRIVNLAATAGPVNALPTEAGYAAAKAGVVGLTRALAMEMIADGVTVNAVAPGIIHTAAST
MVEIKQGLGTPVGRPGTPDEVAAAIAFLCSPAASYVTGQMLVVDGGNSVREAEFR

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF51735	IPR036291	NAD(P)-binding domain superfamily	48	290			4592736	1734904	206	0	0	0	848	0	1
2	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	51	69			4592728	1734904	2301	0	0	0	848	0	2
3	PFAM:PF13561		Enoyl-(Acyl carrier protein) reductase	58	287	187.7	0	4592735	1734904	2302	0	0	0	848	0	3
4	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	121	133			4592730	1734904	2301	0	0	0	848	0	4
5	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	121	133			4592732	1734904	2300	0	0	0	848	0	5
6	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	174	191			4592729	1734904	2301	0	0	0	848	0	6
7	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	180	189			4592734	1734904	2300	0	0	0	848	0	7
8	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	201	221			4592726	1734904	2301	0	0	0	848	0	8
9	PRINTS:PR00080	IPR002347	Short-chain dehydrogenase/reductase (SDR) superfamily signature	201	221			4592733	1734904	2300	0	0	0	848	0	9
10	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	222	240			4592727	1734904	2301	0	0	0	848	0	10
11	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	251	272			4592731	1734904	2301	0	0	0	848	0	11

↑ Top