Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2035: Micromonospora inositola, Utrum1 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#61_02924
Genome uid: 401
3092835-3093551 [+] (238)

Sequence:

RRTSTDVNASDAPPEPPAPRRSGRRDRWADHREQRRQELIGAAVQALLRHGPAVDMDQVAATAGVSKPVLYRYFADKAQL
WLAVSEVVAARVVDAVAPAVEQVREERALVEATIDAYLSVIESEPTLYRFLLHEAGHPGIHQVVAGTSRQVATGLARVIG
DRLRALGLDAGPAEPWAYGLVGFVQAVGDWWATHGQPIRRAALTDYLTTLLWSGIEGVRRAADLPDELTRAHERIER

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	26	104			4626399	1736931	657	0	0	0	2875	0	1
2	PROSITE_PROFILES:PS50977	IPR001647	TetR-type HTH domain profile.	33	93			4626397	1736931	704	0	0	0	2875	0	2
3	PRINTS:PR00455	IPR001647	TetR bacterial regulatory protein HTH signature	39	53			4626393	1736931	1226	0	0	0	2875	0	3
4	PFAM:PF00440	IPR001647	Bacterial regulatory proteins, tetR family	40	85	38.5	7.3E-10	4626395	1736931	702	0	0	0	2875	0	4
5	PRINTS:PR00455	IPR001647	TetR bacterial regulatory protein HTH signature	59	83			4626394	1736931	1226	0	0	0	2875	0	5
6	PFAM:PF19344	IPR045823	Tetracyclin repressor-like, C-terminal domain	98	219	79.6	2.2E-22	4626396	1736931	4889	0	0	0	2875	0	6
7	SUPERFAMILY:SSF48498	IPR036271	Tetracyclin repressor-like, C-terminal domain superfamily	106	218			4626398	1736931	1227	0	0	0	2875	0	7

↑ Top