Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2035: Micromonospora inositola, Utrum1 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#61_03031
Genome uid: 401
3207097-3207672 [+] (191)

Sequence:

EADLHSYLKGGRDALLWKLDGLSEYDIRRPLTRTATNLLGLVKHSAAMEILYFGVVFGRPFEQELPYVGGGAEINADMWA
TADETHEEIVALYRRAIAHADTTIEALALDEVGRVPWWGDAAVTLHHVLVHVIAETQRHAGHADIVRELIDGAAGLLPNN
DNLPPADESWWLDYRQRVEQAALRASKRSN

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF109854	IPR034660	DinB/YfiT-like putative metalloenzymes	2	152			4594807	1737038	2281	0	0	0	2982	0	1
2	PFAM:PF04978	IPR007061	Protein of unknown function (DUF664)	4	153	153.9	4.2039E-45	4594806	1737038	10464	0	0	0	2982	0	2

↑ Top