Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2035: Micromonospora inositola, Utrum1 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#61_03290
Genome uid: 401
3504002-3504763 [+] (253)

Sequence:

SAHVLSNTGVMLGRSIRHVTRSMDTIITVTIMPIAFLLLFRYVFGGAIQAETGNYTNYLMPGILLIAIASGISYTGFRLF
NDMQSGIFERFHSMPIARSSVLWGHVLTSVVSNAISVVIIILVGLLMGFRTSAGVLAWLAVAGVLALFTLSLTWVAMIAG
LAASSTDGATAFSYPLIFLPFISSAFVPTNTMPGPVKAFAEHQPVTAIVNTIRALFEQQPVGNQIWTALAWCAGILVVAY
AFAMRVYRRKIA

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	25			4596529	1737296	18	136:Membrane Protein	0	0	0	3240	0	1
2	DeepTMHMM:inside		inside	1	25			4640680	1737296	9730	0	0	0	3240	0	2
3	PFAM:PF01061	IPR013525	ABC-2 type transporter	8	216	72.3	3.6E-20	4596528	1737296	3716	0	0	0	3240	0	3
4	PROSITE_PROFILES:PS51012	IPR000412	ABC transporter integral membrane type-2 domain profile.	24	251			4596542	1737296	3756	136:Membrane Protein	0	0	0	3240	0	4
5	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	25	45			4596539	1737296	5	136:Membrane Protein	0	0	0	3240	0	5
6	DeepTMHMM:TMhelix		TMhelix	26	46			4640681	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	6
7	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	45	59			4596535	1737296	3	136:Membrane Protein	0	0	0	3240	0	7
8	DeepTMHMM:outside		outside	47	62			4640682	1737296	10025	0	0	0	3240	0	8
9	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	59	81			4596541	1737296	5	136:Membrane Protein	0	0	0	3240	0	9
10	DeepTMHMM:TMhelix		TMhelix	63	78			4640683	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	10
11	DeepTMHMM:inside		inside	79	102			4640684	1737296	9730	0	0	0	3240	0	11
12	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	81	101			4596532	1737296	18	136:Membrane Protein	0	0	0	3240	0	12
13	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	101	130			4596540	1737296	5	136:Membrane Protein	0	0	0	3240	0	13
14	DeepTMHMM:TMhelix		TMhelix	103	128			4640685	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	14
15	DeepTMHMM:outside		outside	129	137			4640686	1737296	10025	0	0	0	3240	0	15
16	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	130	135			4596534	1737296	3	136:Membrane Protein	0	0	0	3240	0	16
17	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	135	163			4596537	1737296	5	136:Membrane Protein	0	0	0	3240	0	17
18	DeepTMHMM:TMhelix		TMhelix	138	159			4640687	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	18
19	DeepTMHMM:inside		inside	160	168			4640688	1737296	9730	0	0	0	3240	0	19
20	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	163	169			4596531	1737296	18	136:Membrane Protein	0	0	0	3240	0	20
21	DeepTMHMM:TMhelix		TMhelix	169	183			4640689	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	21
22	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	169	188			4596538	1737296	5	136:Membrane Protein	0	0	0	3240	0	22
23	DeepTMHMM:outside		outside	184	224			4640690	1737296	10025	0	0	0	3240	0	23
24	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	188	225			4596533	1737296	3	136:Membrane Protein	0	0	0	3240	0	24
25	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	225	244			4596536	1737296	5	136:Membrane Protein	0	0	0	3240	0	25
26	DeepTMHMM:TMhelix		TMhelix	225	245			4640691	1737296	2056	141:DeepTMHMM: helix	0	0	0	3240	6	26
27	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	244	253			4596530	1737296	18	136:Membrane Protein	0	0	0	3240	0	27
28	DeepTMHMM:inside		inside	246	253			4640692	1737296	9730	0	0	0	3240	0	28

↑ Top