Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2035: Micromonospora inositola, Utrum1 [+] (ncbi)

Genbanks info:

Genbank_acc: PaGL#61_03756
Genome uid: 401
4037119-4038096 [+] (325)

Sequence:

RFLLQRTAFYLFTAWAAITLNFFIPRLVPGDPVQSLISRNQGRISADAIESLRVLFGLDAHENIWQQYLDYWRQLLHGDL
GLSFTFFPTPVSTVIGDSLPWTVGLVGITTIISFLVGTGLGVGAGWRRGSWVDGLLPATTFLSSIPYFWLGLVAIAVFTG
PGSFFPSSGGYEAGLVPAFDGYFIPSAIKHSVLPAATILVSSMSGWILSMRNMMVTVSSEDYITVAHAKGLSERRVALSY
AARNALLPNVSGFALSLGFIVGGTLLVEIVFSYPGLGYQLFQAVGYKDYPLMQGIFLIITISVLVANLLADVAYLLLDPR
TRKS

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	8			4602411	1737761	18	136:Membrane Protein	0	0	0	3705	0	1
2	DeepTMHMM:inside		inside	1	7			4641989	1737761	9730	0	0	0	3705	0	2
3	DeepTMHMM:TMhelix		TMhelix	8	29			4641990	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	3
4	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	8	29			4602419	1737761	5	136:Membrane Protein	0	0	0	3705	0	4
5	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	29	101			4602415	1737761	3	136:Membrane Protein	0	0	0	3705	0	5
6	DeepTMHMM:outside		outside	30	99			4641991	1737761	10025	0	0	0	3705	0	6
7	SUPERFAMILY:SSF161098	IPR035906	MetI-like superfamily	95	323			4602426	1737761	225	0	0	0	3705	0	7
8	CDD:cd06261	IPR000515	TM_PBP2	99	304			4602425	1737761	224	0	0	0	3705	0	8
9	PROSITE_PROFILES:PS50928	IPR000515	ABC transporter integral membrane type-1 domain profile.	99	311			4602424	1737761	223	136:Membrane Protein	0	0	0	3705	0	9
10	DeepTMHMM:TMhelix		TMhelix	100	122			4641992	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	101	127			4602423	1737761	5	136:Membrane Protein	0	0	0	3705	0	11
12	PFAM:PF00528	IPR000515	Binding-protein-dependent transport system inner membrane component	117	324	141.3	2.79993E-41	4602410	1737761	220	136:Membrane Protein	0	0	0	3705	0	12
13	DeepTMHMM:inside		inside	123	134			4641993	1737761	9730	0	0	0	3705	0	13
14	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	127	147			4602412	1737761	18	136:Membrane Protein	0	0	0	3705	0	14
15	DeepTMHMM:TMhelix		TMhelix	135	155			4641994	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	15
16	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	147	168			4602420	1737761	5	136:Membrane Protein	0	0	0	3705	0	16
17	DeepTMHMM:outside		outside	156	187			4641995	1737761	10025	0	0	0	3705	0	17
18	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	168	187			4602416	1737761	3	136:Membrane Protein	0	0	0	3705	0	18
19	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	187	209			4602418	1737761	5	136:Membrane Protein	0	0	0	3705	0	19
20	DeepTMHMM:TMhelix		TMhelix	188	210			4641996	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	20
21	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	209	253			4602413	1737761	18	136:Membrane Protein	0	0	0	3705	0	21
22	DeepTMHMM:inside		inside	211	245			4641997	1737761	9730	0	0	0	3705	0	22
23	DeepTMHMM:TMhelix		TMhelix	246	272			4641998	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	23
24	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	253	275			4602422	1737761	5	136:Membrane Protein	0	0	0	3705	0	24
25	DeepTMHMM:outside		outside	273	293			4641999	1737761	10025	0	0	0	3705	0	25
26	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	275	294			4602417	1737761	3	136:Membrane Protein	0	0	0	3705	0	26
27	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	294	318			4602421	1737761	5	136:Membrane Protein	0	0	0	3705	0	27
28	DeepTMHMM:TMhelix		TMhelix	294	314			4642000	1737761	2056	141:DeepTMHMM: helix	0	0	0	3705	6	28
29	DeepTMHMM:inside		inside	315	325			4642001	1737761	9730	0	0	0	3705	0	29
30	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	318	325			4602414	1737761	18	136:Membrane Protein	0	0	0	3705	0	30

↑ Top