Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Batch4_genome_fasta/bc2038: Terrisporobacter hibernicus, CB-LS-10-2 [+] (ncbi)

Genbanks info:

Genbank_acc: AnGL54_01927
Genome uid: 403
1946208-1947629 [+] (473)

Sequence:

ELLNNLILSVSDVLWSKILIVMLIVLGLYFTFRTKFVQFRYFGEMFRLLGDGAKGEKKEGAVSSFQAFCISTASRVGTGN
IAGIAMAVVAGGPGSVFWMWLIALIGSASSFVESTLAQIFKVKDGEGFRGGPAYYIEQGLGSKKMGMLFSILITICYGFV
FNAVQSNTITAAFNNAFGVDKFVIGVIIAILTGLVIFGGVHRVAKVSELIVPVLAVTYILVALFVVVINITEIPGIIVTI
FESAFGVREMAVGSMSGMILVGIKRGLFSNEAGMGSAPNAAATADTTHPVKQGLIQSLGVFTDTIVICSCTAFIILLYPK
YSTAGLDGIQLTQAALSSHIGSIGYVFLAICILLFAFSSIVGNYYYGQSNIEFMSNNKTVMNVFRALVVAMVLFGSVATV
EIVWNLADVFMGLMAIINLVAIALIGKYAFIALQDYTDQKKAGIKEPVFDASNIKGLENIEHWRNDRQDKAM

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF52317	IPR029062	Class I glutamine amidotransferase-like	0	158			2975651	1748438	798	0	0	0	2096	0	1
2	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	14			4720712	1748438	3	136:Membrane Protein	0	0	0	2096	0	2
3	DeepTMHMM:outside		outside	1	14			4749546	1748438	10025	0	0	0	2096	0	3
4	PFAM:PF02016	IPR040449	LD-carboxypeptidase N-terminal domain	12	130	128.3	1.5E-37	2975649	1748438	4909	0	0	0	2096	0	4
5	CDD:cd07025		Peptidase_S66	12	286			2975650	1748438	5198	0	0	0	2096	0	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	14	33			4720717	1748438	5	136:Membrane Protein	0	0	0	2096	0	6
7	DeepTMHMM:TMhelix		TMhelix	15	33			4749547	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	7
8	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	33	67			4720709	1748438	18	136:Membrane Protein	0	0	0	2096	0	8
9	DeepTMHMM:inside		inside	34	70			4749548	1748438	9730	0	0	0	2096	0	9
10	PFAM:PF01235	IPR001463	Sodium:alanine symporter family	55	450	530	0	4720704	1748438	4712	0	0	0	2096	0	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	67	92			4720727	1748438	5	136:Membrane Protein	0	0	0	2096	0	11
12	DeepTMHMM:TMhelix		TMhelix	71	88			4749549	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	12
13	DeepTMHMM:outside		outside	89	94			4749550	1748438	10025	0	0	0	2096	0	13
14	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	91	114			4720698	1748438	4711	0	0	0	2096	0	14
15	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	92	97			4720711	1748438	3	136:Membrane Protein	0	0	0	2096	0	15
16	DeepTMHMM:TMhelix		TMhelix	95	115			4749551	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	16
17	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	97	121			4720726	1748438	5	136:Membrane Protein	0	0	0	2096	0	17
18	DeepTMHMM:inside		inside	116	149			4749552	1748438	9730	0	0	0	2096	0	18
19	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	121	145			4720708	1748438	18	136:Membrane Protein	0	0	0	2096	0	19
20	SUPERFAMILY:SSF141986	IPR027461	LD-carboxypeptidase A, C-terminal domain superfamily	140	296			2975652	1748438	4912	0	0	0	2096	0	20
21	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	145	165			4720722	1748438	5	136:Membrane Protein	0	0	0	2096	0	21
22	DeepTMHMM:TMhelix		TMhelix	150	165			4749553	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	22
23	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	165	176			4720716	1748438	3	136:Membrane Protein	0	0	0	2096	0	23
24	DeepTMHMM:outside		outside	166	182			4749554	1748438	10025	0	0	0	2096	0	24
25	PFAM:PF17676	IPR040921	LD-carboxypeptidase C-terminal domain	175	290	112.4	1.9E-32	2975648	1748438	4910	0	0	0	2096	0	25
26	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	176	198			4720723	1748438	5	136:Membrane Protein	0	0	0	2096	0	26
27	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	181	200			4720702	1748438	4711	0	0	0	2096	0	27
28	DeepTMHMM:TMhelix		TMhelix	183	201			4749555	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	28
29	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	198	209			4720706	1748438	18	136:Membrane Protein	0	0	0	2096	0	29
30	DeepTMHMM:inside		inside	202	208			4749556	1748438	9730	0	0	0	2096	0	30
31	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	209	231			4720721	1748438	5	136:Membrane Protein	0	0	0	2096	0	31
32	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	209	229			4720703	1748438	4711	0	0	0	2096	0	32
33	DeepTMHMM:TMhelix		TMhelix	209	229			4749557	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	33
34	DeepTMHMM:outside		outside	230	250			4749558	1748438	10025	0	0	0	2096	0	34
35	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	231	236			4720713	1748438	3	136:Membrane Protein	0	0	0	2096	0	35
36	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	236	262			4720720	1748438	5	136:Membrane Protein	0	0	0	2096	0	36
37	DeepTMHMM:TMhelix		TMhelix	251	273			4749559	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	37
38	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	262	298			4720710	1748438	18	136:Membrane Protein	0	0	0	2096	0	38
39	DeepTMHMM:inside		inside	274	293			4749560	1748438	9730	0	0	0	2096	0	39
40	DeepTMHMM:TMhelix		TMhelix	294	316			4749561	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	40
41	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	298	320			4720724	1748438	5	136:Membrane Protein	0	0	0	2096	0	41
42	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	300	319			4720700	1748438	4711	0	0	0	2096	0	42
43	DeepTMHMM:outside		outside	317	345			4749562	1748438	10025	0	0	0	2096	0	43
44	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	320	339			4720715	1748438	3	136:Membrane Protein	0	0	0	2096	0	44
45	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	339	363			4720719	1748438	5	136:Membrane Protein	0	0	0	2096	0	45
46	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	345	368			4720699	1748438	4711	0	0	0	2096	0	46
47	DeepTMHMM:TMhelix		TMhelix	346	368			4749563	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	47
48	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	363	383			4720707	1748438	18	136:Membrane Protein	0	0	0	2096	0	48
49	DeepTMHMM:inside		inside	369	380			4749564	1748438	9730	0	0	0	2096	0	49
50	DeepTMHMM:TMhelix		TMhelix	381	401			4749565	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	50
51	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	383	405			4720718	1748438	5	136:Membrane Protein	0	0	0	2096	0	51
52	DeepTMHMM:outside		outside	402	406			4749566	1748438	10025	0	0	0	2096	0	52
53	PRINTS:PR00175	IPR001463	Sodium/alanine symporter signature	405	426			4720701	1748438	4711	0	0	0	2096	0	53
54	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	405	410			4720714	1748438	3	136:Membrane Protein	0	0	0	2096	0	54
55	DeepTMHMM:TMhelix		TMhelix	407	427			4749567	1748438	2056	141:DeepTMHMM: helix	0	0	0	2096	6	55
56	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	410	432			4720725	1748438	5	136:Membrane Protein	0	0	0	2096	0	56
57	DeepTMHMM:inside		inside	428	473			4749568	1748438	9730	0	0	0	2096	0	57
58	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	432	473			4720705	1748438	18	136:Membrane Protein	0	0	0	2096	0	58

↑ Top