Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Methanospirillum.hungatei.JF-1: Methanospirillum.hungatei.JF-1, MhunJF1 [-] (IMG)

Genbanks info:

Genbank_acc: Ga0065338_11229:Mhun_00228
Genome uid: 406
211380-212498 [+] (372)

Sequence:

TSDYASIISQSLNTLPVGICIIREDHTITFWNRTIETWTGISQIQAEGRVLEDVVPVFREHHEKSRLKVVFKGGGPVILS
SRFHPRIFPLRDNSQNEGKYQRIIISPFILQDEGTQAIITVEDVTAITEQVFMYRQIKDQLAFELEEKKITQRALEMALS
KLNNLASITRHDLLNSLTVFEGYLGIILNQEPGGKIQTYLEKMRESTLSMKRHITFARDYQEMGNAVPAWYHVESLVKNS
GIGPNFRDIIIETNTGNLEILADPLIVKAVYNLLENAVRHGEHTTHITVSHVKGPDSVTIILEDNGVGVPSDKKGRIFNK
GFGSNTGLGLFLTREILGITGMQIIETGTPGKGARFEIRVPAGHFRYPGEE

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SMART:SM00091	IPR000014		6	73			4898230	1762945	1	0	0	0	222	0	1
2	SUPERFAMILY:SSF55785	IPR035965	PAS domain superfamily	10	82			4898238	1762945	289	0	0	0	222	0	2
3	PFAM:PF00989	IPR013767	PAS fold	12	58	29.4	6.2E-7	4898232	1762945	453	0	0	0	222	0	3
4	CDD:cd00130	IPR000014	PAS	15	105			4898236	1762945	285	0	0	0	222	0	4
5	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	247	364			4898237	1762945	122	0	0	0	222	0	5
6	SMART:SM00387	IPR003594		261	365			4898231	1762945	1	0	0	0	222	0	6
7	PROSITE_PROFILES:PS50109	IPR005467	Histidine kinase domain profile.	266	365			4898234	1762945	103	0	0	0	222	0	7
8	PFAM:PF02518	IPR003594	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	267	363	47.8	1.7E-12	4898233	1762945	99	0	0	0	222	0	8
9	CDD:cd00075		HATPase	269	360			4898235	1762945	456	0	0	0	222	0	9
10	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	298	313			4898228	1762945	95	0	0	0	222	0	10
11	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	324	343			4898227	1762945	95	0	0	0	222	0	11
12	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	348	362			4898229	1762945	95	0	0	0	222	0	12

↑ Top