Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000255615.2: Acetivibrio thermocellus, AD2 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_003514399.1:BCBBJIPK_00375
Genome uid: 68
398404-399102 [+] (232)

Sequence:

NNHICSCERCQHKICAKRVPIFSTLNSEEINKVVNLIIRKRYSRGEMIVLEGSHLDRLIIINSGKVKAFRNTFEGKEQIL
YIFSQGDFFGEKNLLINQTAQYNVEALEETHVCTIKKNDFKNLLREYPEIGLKIIEELCNRLERLENAVENMGTKNAEER
VSAVLLEFARKYGKESQNGIIVELPLSREGIANYIGVARETVSRKMNMLQEEGIIEMVGNKKVIIRNIDAL

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF51206	IPR018490	Cyclic nucleotide-binding domain superfamily	17	155			2507970	260982	3133	0	0	1	363	0	1
2	SMART:SM00100	IPR000595		21	143			2507962	260982	1	0	0	1	363	0	2
3	PROSITE_PROFILES:PS50042	IPR000595	cAMP/cGMP binding motif profile.	21	142			2507966	260982	3130	0	0	1	363	0	3
4	CDD:cd00038	IPR000595	CAP_ED	21	136			2507967	260982	3131	0	0	1	363	0	4
5	PFAM:PF00027	IPR000595	Cyclic nucleotide-binding domain	39	128	76.4	1.4E-21	2507963	260982	3127	0	0	1	363	0	5
6	PROSITE_PROFILES:PS51063	IPR012318	Crp-type HTH domain profile.	155	230			2507965	260982	3129	0	0	1	363	0	6
7	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	156	232			2507969	260982	42	0	0	1	363	0	7
8	CDD:cd00092		HTH_CRP	157	228			2507968	260982	3132	0	0	1	363	0	8
9	PFAM:PF13545	IPR012318	Crp-like helix-turn-helix domain	159	232	60.4	1.2E-16	2507964	260982	3128	0	0	1	363	0	9
10	SMART:SM00419	IPR012318		178	228			2507961	260982	1	0	0	1	363	0	10
11	PRINTS:PR00034	IPR012318	CRP bacterial regulatory protein HTH signature	184	201			2507959	260982	3126	0	0	1	363	0	11
12	PRINTS:PR00034	IPR012318	CRP bacterial regulatory protein HTH signature	200	216			2507960	260982	3126	0	0	1	363	0	12

↑ Top