Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000255615.2: Acetivibrio thermocellus, AD2 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_003516110.1:BCBBJIPK_00766
Genome uid: 68
842504-843694 [+] (396)

Sequence:

NERVYGDEFVEDEFASEVVIESVNVDESEELKPPRIEAKAAIVIDADTGRVLYEKDAYSRRAIASTTKIMTAIVAIENGN
LDDKVKVSSRAASIWGSTIKLKPGEELTLKELLYGMMLRSGNDAALAVAEHVGGTVENFVKMMNDKARELGLKNTAFKTP
HGLDVEGHYSTAYELAMLTRYALQNPVFAQIVATKSTTITNRSLYTTNEMLSLYPGADGVKTGYTGKAGRCLVTSATRDG
FKIISVVLNCSSRSKRAESSKTILDYAFNNYKPYELLRANQELGRVKVYKGKKDSVPVVAVESIKMPLSREEKEKLRTEL
TLDETIKAPVYKGVEVGKIEFFVDGKLIGRSAVKTAEAVPEKSYGDYFREILDMWFKLARLNLSGVFAKSLNIMQ

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PFAM:PF00768	IPR001967	D-alanyl-D-alanine carboxypeptidase	32	251	242.4	0	2518287	262856	555	14	0	1	736	0	1
2	SUPERFAMILY:SSF56601	IPR012338	Beta-lactamase/transpeptidase-like	32	272			2518293	262856	558	14	0	1	736	0	2
3	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	64	76			2518284	262856	554	14	0	1	736	0	3
4	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	112	130			2518285	262856	554	14	0	1	736	0	4
5	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	139	153			2518283	262856	554	14	0	1	736	0	5
6	SUPERFAMILY:SSF69189	IPR015956	Penicillin-binding protein, C-terminal domain superfamily	263	360			2518291	262856	557	14	0	1	736	0	6
7	SMART:SM00936	IPR012907		271	362			2518286	262856	1	14	0	1	736	0	7
8	PFAM:PF07943	IPR012907	Penicillin-binding protein 5, C-terminal domain	271	362	74.6	5.6E-21	2518289	262856	556	14	0	1	736	0	8

↑ Top