We will take the links to it out when ready.
GCF_001481725.1: Eubacterium limosum, SA11 [+] (ncbi)
KLFDHQLDKNIPVPLYYQLKTLLEEYIEKEHTNYEEPIPTEMEISEAFGISRPTVRQAINSLVVEGKLYRKKSKGTFVNR PKIHQNFLESIQSFNEEMKEKGLTPKTEVLGLEVVACDEEVGRALQLEVGTEVVRLERLRYADGEPIVHVVSHLPHSLCG EMLEKDFTRVSMYHVMEAELGMTIDYATRRLEAILADSSTAKILGISKGSAIQYIQTIAYLTDETAVEYSKAYYRGDRSH FTFKLKRN
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 12 | 90 | 224409 | 324487 | 42 | 0 | 0 | 1 | 2080 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 13 | 82 | 224407 | 324487 | 323 | 0 | 0 | 1 | 2080 | 0 | 2 | |||
| 3 | CDD:cd07377 | IPR000524 | WHTH_GntR | 14 | 80 | 224408 | 324487 | 324 | 0 | 0 | 1 | 2080 | 0 | 3 | |||
| 4 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 16 | 79 | 56.9 | 1.2E-15 | 224405 | 324487 | 322 | 0 | 0 | 1 | 2080 | 0 | 4 | |
| 5 | SMART:SM00345 | IPR000524 | 19 | 79 | 224404 | 324487 | 1 | 0 | 0 | 1 | 2080 | 0 | 5 | ||||
| 6 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 38 | 53 | 224401 | 324487 | 2145 | 0 | 0 | 1 | 2080 | 0 | 6 | |||
| 7 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 52 | 69 | 224402 | 324487 | 2145 | 0 | 0 | 1 | 2080 | 0 | 7 | |||
| 8 | SUPERFAMILY:SSF64288 | IPR028978 | Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily | 66 | 248 | 224410 | 324487 | 2147 | 0 | 0 | 1 | 2080 | 0 | 8 | |||
| 9 | SMART:SM00866 | IPR011663 | 100 | 241 | 224403 | 324487 | 1 | 0 | 0 | 1 | 2080 | 0 | 9 | ||||
| 10 | PFAM:PF07702 | IPR011663 | UTRA domain | 101 | 239 | 138.9 | 9.99995E-41 | 224406 | 324487 | 2146 | 0 | 0 | 1 | 2080 | 0 | 10 |