Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

GCF_002222595.2: Blautia hansenii, DSM 20583 [+] (ncbi)

Sequence:

LILVIMCIGICIGNKFLSPKYKKANEIFQIMCTLSLIFSMGVMLGQDDNFFDKLFTLGWESFLFFLVPSVCSVILVFILT
KRFMDDKRKKEKD

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	27			3077501	334066	18	136:Membrane Protein	15	0	1	1665	0	1
2	DeepTMHMM:outside		outside	1	1			3073218	334066	10025	15	0	1	1665	0	2
3	DeepTMHMM:TMhelix		TMhelix	2	15			3073219	334066	2056	141:DeepTMHMM: helix	15	0	1	1665	5	3
4	DeepTMHMM:inside		inside	16	26			3073220	334066	9730	15	0	1	1665	0	4
5	DeepTMHMM:TMhelix		TMhelix	27	47			3073221	334066	2056	141:DeepTMHMM: helix	15	0	1	1665	5	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	27	46			3077510	334066	5	136:Membrane Protein	15	0	1	1665	0	6
7	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	46	57			3077504	334066	3	136:Membrane Protein	15	0	1	1665	0	7
8	DeepTMHMM:outside		outside	48	59			3073222	334066	10025	15	0	1	1665	0	8
9	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	57	81			3077507	334066	5	136:Membrane Protein	15	0	1	1665	0	9
10	DeepTMHMM:TMhelix		TMhelix	60	80			3073223	334066	2056	141:DeepTMHMM: helix	15	0	1	1665	5	10
11	DeepTMHMM:inside		inside	81	94			3073224	334066	9730	15	0	1	1665	0	11
12	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	81	94			3077466	334066	18	136:Membrane Protein	15	0	1	1665	0	12

↑ Top