Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_001455105.1: Fusobacterium hwasookii, ChDC F300 [-] (ncbi)

Genbanks info:

Genbank_acc: WP_029492239.1:AFDNOBJL_00830
Genome uid: 88
743920-745500 [+] (526)

Sequence:

EKIQGLENIDKVDEFIKLTEQALKDEEKYKIWNAGKSMYGIYGERDKGTYMVRPRFIESKITLDNLTFFLNLAEKYGDKR
LHLTTRQDIQLHGNKKENLAKILKELKANGFVTKATGGDAARAVITPPATGFEEEIINVAPYSKIVTEHILETGDFMFLP
RKFKVAFSNKRENSLYVKIADVGFEAIEKNGIKGFRVFGGGSLGNSPKEAIILKDFIEHHDILYYVIAMRNLFNEHGDRK
IRGKARLRFILIKLGDEEFLKLFNVYLDELYKKEGDKYKNIVLEKLKKYKNPYEVKAIKEDKKENLIKSSNIVKGKIEGR
YGYYIRLPKGDIDIKEGNKLVEFLKNLDYKIEMRLTSHQELFIANLKKEDVYILDKLSNKYSKKRFFSSISCIGSTICNP
GILDTPPILEMILKYFKNKQRLASYLPKIQLSGCPNSCAAHQIAELGFQGKRKKDGAYFNVFIGGEFETKDVVTLNKSVG
ELKAETIPLFLEEMAKILKERKITYEIYSKQDDFIDLVKKFEGVI

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF55124	IPR036136	Nitrite/Sulfite reductase ferredoxin-like domain superfamily	6	118			274446	353919	1644	0	0	1	833	0	1
2	PFAM:PF03460	IPR005117	Nitrite/Sulfite reductase ferredoxin-like half domain	44	109	57	1.3E-15	274439	353919	1643	0	0	1	833	0	2
3	SUPERFAMILY:SSF56014	IPR045854	Nitrite and sulphite reductase 4Fe-4S domain-like superfamily	118	275			274444	353919	416	0	0	1	833	0	3
4	PFAM:PF01077	IPR006067	Nitrite and sulphite reductase 4Fe-4S domain	119	268	88.5	3.0E-25	274437	353919	1642	0	0	1	833	0	4
5	SUPERFAMILY:SSF55124	IPR036136	Nitrite/Sulfite reductase ferredoxin-like domain superfamily	249	399			274448	353919	1644	0	0	1	833	0	5
6	PRINTS:PR00397	IPR006066	Sirohaem Fe-binding site signature	387	406			274433	353919	5434	0	0	1	833	0	6
7	PFAM:PF01077	IPR006067	Nitrite and sulphite reductase 4Fe-4S domain	389	493	43.2	2.7E-11	274436	353919	1642	0	0	1	833	0	7
8	SUPERFAMILY:SSF56014	IPR045854	Nitrite and sulphite reductase 4Fe-4S domain-like superfamily	389	507			274441	353919	416	0	0	1	833	0	8
9	PRINTS:PR00397	IPR006066	Sirohaem Fe-binding site signature	432	451			274434	353919	5434	0	0	1	833	0	9

↑ Top