Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000024685.1: Paenibacillus sp., Y412MC10 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_015735299.1:ENGBPLDF_03073
Genome uid: 74
3521489-3522796 [+] (435)

Sequence:

GFEIEQTTGDSSWYTHDRFGMFIHWGLYSLGARHEWMKGREFMTNEQYDKYFKRFDPDLYDPELWATLASDAGMKYFVVT
TKHHEGFCLWDSALTDYKATNTPAGRDLLTPMIEAFKSKNIRPGLYYSLLDWHHRHYTLDVKHPLRYNKEFLEDQKHREW
QKYVDYMHEQTRELLTKFGKIDLMFFDFSIPSEQGFPGKGKEEWQSEKLVKLIRELQPHILLNDRLQVKGDITTPEQYQP
REWIQTNGKRVVWEACHTFSGSWGYYRDEETWKSVDTLVKMLIDTVSKGGNLLLNVGPTGRGEFDERAIDRLKGIGEWMK
RHSKSIYGCTAAPEELQCPEDCRFTYNPENNRLYLHVYSWPFKHIHLRGLTGMVEYAQLLNDASEIKMKQGEEEMTMEAG
AFNEGRPRDILTLLLPVKKPNVTVPVIELFLKSR

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SMART:SM00812	IPR000933		1	371			2820512	354111	1	0	0	1	3026	0	1
2	PFAM:PF01120	IPR000933	Alpha-L-fucosidase	11	324	296.5	0	2820513	354111	5118	0	0	1	3026	0	2
3	SUPERFAMILY:SSF51445	IPR017853	Glycoside hydrolase superfamily	12	328			2820514	354111	525	0	0	1	3026	0	3
4	PRINTS:PR00741	IPR016286	Glycosyl hydrolase family 29 signature	76	93			2820506	354111	5117	202:GH29	0	0	1	3026	4	4
5	PRINTS:PR00741	IPR016286	Glycosyl hydrolase family 29 signature	121	141			2820510	354111	5117	202:GH29	0	0	1	3026	4	5
6	PRINTS:PR00741	IPR016286	Glycosyl hydrolase family 29 signature	277	299			2820504	354111	5117	202:GH29	0	0	1	3026	4	6
7	PRINTS:PR00741	IPR016286	Glycosyl hydrolase family 29 signature	310	333			2820508	354111	5117	202:GH29	0	1	1	3026	4	7

↑ Top