Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_009913495.1: Bacillus velezensis, SRCM102747 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_012118258.1:BPDKFNGG_01970
Genome uid: 82
1921019-1921831 [+] (270)

Sequence:

KNSSGTIEQLHQQFKKRHQKEKLRIRAYQAAIFIVFFAGWEISSRAGWIDPLIFSSPSAVCRLLVEKIADGSLAAHIGVT
LGETVLGFLFGTLLGTCLAALLWWSNRLARVLDPYLVILNAMPKVALGPILIVALGPNFTSIVAMGAVISVIITTIVVFT
AFQEVDENYIKVMKTFGAKRSIMFKEVILPACAPAIISALKVNVGLSWVGVIVGEFLVSEKGLGYMIIYGFQVFNFTLVF
LSLLIIAIFATLMYQGVELLERKWTKGKI

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	25			62328	363977	18	136:Membrane Protein	15	0	1	1861	0	1
2	DeepTMHMM:inside		inside	1	25			110394	363977	9730	15	0	1	1861	0	2
3	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	25	43			62322	363977	5	136:Membrane Protein	15	0	1	1861	0	3
4	DeepTMHMM:TMhelix		TMhelix	26	45			110396	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	4
5	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	43	85			62332	363977	3	136:Membrane Protein	15	0	1	1861	0	5
6	DeepTMHMM:outside		outside	46	77			110398	363977	10025	15	0	1	1861	0	6
7	SUPERFAMILY:SSF161098	IPR035906	MetI-like superfamily	71	253			62337	363977	225	15	0	1	1861	0	7
8	PROSITE_PROFILES:PS50928	IPR000515	ABC transporter integral membrane type-1 domain profile.	73	255			62335	363977	223	136:Membrane Protein	15	0	1	1861	0	8
9	CDD:cd06261	IPR000515	TM_PBP2	77	253			62336	363977	224	15	0	1	1861	0	9
10	DeepTMHMM:TMhelix		TMhelix	78	105			110399	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	85	105			62314	363977	5	136:Membrane Protein	15	0	1	1861	0	11
12	PFAM:PF00528	IPR000515	Binding-protein-dependent transport system inner membrane component	92	264	81.8	5.2E-23	62307	363977	220	136:Membrane Protein	15	0	1	1861	0	12
13	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	105	116			62330	363977	18	136:Membrane Protein	15	0	1	1861	0	13
14	DeepTMHMM:inside		inside	106	115			110400	363977	9730	15	0	1	1861	0	14
15	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	116	137			62309	363977	5	136:Membrane Protein	15	0	1	1861	0	15
16	DeepTMHMM:TMhelix		TMhelix	116	136			110401	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	16
17	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	137	142			62333	363977	3	136:Membrane Protein	15	0	1	1861	0	17
18	DeepTMHMM:outside		outside	137	139			110402	363977	10025	15	0	1	1861	0	18
19	DeepTMHMM:TMhelix		TMhelix	140	160			110403	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	19
20	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	142	163			62316	363977	5	136:Membrane Protein	15	0	1	1861	0	20
21	DeepTMHMM:inside		inside	161	196			110404	363977	9730	15	0	1	1861	0	21
22	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	163	183			62324	363977	18	136:Membrane Protein	15	0	1	1861	0	22
23	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	183	207			62319	363977	5	136:Membrane Protein	15	0	1	1861	0	23
24	DeepTMHMM:TMhelix		TMhelix	197	219			110405	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	24
25	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	207	226			62334	363977	3	136:Membrane Protein	15	0	1	1861	0	25
26	DeepTMHMM:outside		outside	220	239			110406	363977	10025	15	0	1	1861	0	26
27	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	226	255			62311	363977	5	136:Membrane Protein	15	0	1	1861	0	27
28	DeepTMHMM:TMhelix		TMhelix	240	261			110407	363977	2056	141:DeepTMHMM: helix	15	0	1	1861	5	28
29	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	255	270			62326	363977	18	136:Membrane Protein	15	0	1	1861	0	29
30	DeepTMHMM:inside		inside	262	270			110408	363977	9730	15	0	1	1861	0	30

↑ Top