Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_002243515.1: Tumebacillus algifaecis, THMBR28 [+] (ncbi)

Genbanks info:

Genbank_acc: JDJFOMJM_02734
Genome uid: 98
3116630-3117364 [+] (244)

Sequence:

KLPVPMKLRLQGRIWFLNLLFKMGGTPEEIYYVGGSEALPPPLTREEEEYLLGKLPTKDEGVRAVLIERNLRLVVYIARK
FENTGINIEDLVSIGTIGLIKAVNTFDPEKKIKLATYASRCIENEILMFLRRNNKIRSEVSFDEPLNVDWDGNELLLSDV
LGTENDTIYRNIEEQVDRKLLYKALEKLTDRERKIMEMRFGLTDGKEMTQKDVADLLGISQSYISRLEKRIIKRLRKEFN
KML

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF88946	IPR013325	RNA polymerase sigma factor, region 2	30	136			761847	401455	458	0	0	1	2629	0	1
2	PFAM:PF04542	IPR007627	Sigma-70 region 2	66	136	67.8	5.2E-19	761839	401455	593	0	0	1	2629	0	2
3	PRINTS:PR00046	IPR000943	Major sigma-70 factor signature	90	104			761832	401455	1068	0	0	1	2629	0	3
4	SUPERFAMILY:SSF88659	IPR013324	RNA polymerase sigma factor, region 3/4-like	147	242			761849	401455	595	0	0	1	2629	0	4
5	CDD:cd06171		Sigma70_r4	178	237			761845	401455	594	0	0	1	2629	0	5
6	PFAM:PF04545	IPR007630	Sigma-70, region 4	184	238	59.9	1.2E-16	761841	401455	592	0	0	1	2629	0	6
7	PRINTS:PR00046	IPR000943	Major sigma-70 factor signature	188	201			761834	401455	1068	0	0	1	2629	0	7
8	PROSITE_PROFILES:PS50943	IPR001387	Cro/C1-type HTH domain profile.	208	230			761843	401455	333	0	0	1	2629	0	8
9	PRINTS:PR00046	IPR000943	Major sigma-70 factor signature	209	225			761837	401455	1068	0	0	1	2629	0	9
10	PRINTS:PR00046	IPR000943	Major sigma-70 factor signature	224	236			761835	401455	1068	0	0	1	2629	0	10

↑ Top