We will take the links to it out when ready.
GCF_000244875.1: Clostridium sp., BNL1100 [+] (ncbi)
INKFSSIPLYLQLKDLLIKKIENNEFPANSQIPSEQDLCQMYDISRPTVRQAVSELTNSGYLYKEKGKGTFVYGRKNVID IKDYSGFTDSVLDCQTPAEKNIIDLKDIGSSSIGQLNEIFNFNSSMAIAEITYLSFINNQRNEVYSLNKSYISLSLFPDI ISQLKDGKSSIDILRGKYPLIPDKSRSILEIVFADQNDSPLLRVQPGQPLIKLQNTLFSKSGQPVEYIISKYRADNCRLL FENSK
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 0 | 77 | 464309 | 41288 | 42 | 0 | 0 | 1 | 1756 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 7 | 76 | 464306 | 41288 | 323 | 0 | 0 | 1 | 1756 | 0 | 2 | |||
| 3 | CDD:cd07377 | IPR000524 | WHTH_GntR | 8 | 73 | 464307 | 41288 | 324 | 0 | 0 | 1 | 1756 | 0 | 3 | |||
| 4 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 9 | 73 | 54.9 | 5.2E-15 | 464305 | 41288 | 322 | 0 | 0 | 1 | 1756 | 0 | 4 | |
| 5 | SMART:SM00345 | IPR000524 | 13 | 73 | 464303 | 41288 | 1 | 0 | 0 | 1 | 1756 | 0 | 5 | ||||
| 6 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 32 | 47 | 464301 | 41288 | 2145 | 0 | 0 | 1 | 1756 | 0 | 6 | |||
| 7 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 46 | 63 | 464300 | 41288 | 2145 | 0 | 0 | 1 | 1756 | 0 | 7 | |||
| 8 | SUPERFAMILY:SSF64288 | IPR028978 | Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily | 60 | 243 | 464308 | 41288 | 2147 | 0 | 0 | 1 | 1756 | 0 | 8 | |||
| 9 | SMART:SM00866 | IPR011663 | 107 | 239 | 464302 | 41288 | 1 | 0 | 0 | 1 | 1756 | 0 | 9 | ||||
| 10 | PFAM:PF07702 | IPR011663 | UTRA domain | 141 | 237 | 57.9 | 9.5E-16 | 464304 | 41288 | 2146 | 0 | 0 | 1 | 1756 | 0 | 10 |