Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_017549005.1: Ruminococcus sp., RGIG7544 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_296571907.1:PROKKA_00469
Genome uid: 108
2699-3625 [+] (308)

Sequence:

INFYNYEKGVLTQCDAPVAGCWVSVVDPTPQEVKELIEDYGLDSGFVKSSIDEEESSRIEREDDQTLVIIDTPVSAIDDD
KTKNFYTLPMGIIVTAEYVFTISIRETQIINEATRGGIRNLRPDFKTRFVLQLLLRISALFLTYLKQIDKISSAAEQELH
DAMKNELLMQLLALEKSLVYFSTSLKANEATIEKIFRGRVIKLYDEDQDLLEDVLIEMKQAIEMSSIYSGILSSMMDGFS
SIISNNQNTVMWRLTIVTIILEIPNIMFAFYGINTEDIPFNYTWVALTLTALLTGITAFALLKWKKK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	129			1041257	429700	3	136:Membrane Protein	15	0	1	146	0	1
2	SUPERFAMILY:SSF143865	IPR045861	CorA, cytoplasmic domain	1	246			1041264	429700	3659	15	0	1	146	0	2
3	DeepTMHMM:inside		inside	1	254			1069201	429700	9730	15	0	1	146	0	3
4	PFAM:PF01544	IPR002523	CorA-like Mg2+ transporter protein	21	302	150.7	5.1848E-44	1041255	429700	3657	15	0	1	146	0	4
5	CDD:cd12827		EcCorA_ZntB-like_u2	22	308			1041263	429700	3658	15	0	1	146	0	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	129	146			1041258	429700	5	136:Membrane Protein	15	0	1	146	0	6
7	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	146	250			1041261	429700	18	136:Membrane Protein	15	0	1	146	0	7
8	SUPERFAMILY:SSF144083	IPR045863	CorA, transmembrane region	246	305			1041265	429700	3660	137:Transmembrane	15	0	1	146	0	8
9	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	250	271			1041260	429700	5	136:Membrane Protein	15	0	1	146	0	9
10	DeepTMHMM:TMhelix		TMhelix	255	274			1069202	429700	2056	141:DeepTMHMM: helix	15	0	1	146	5	10
11	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	271	282			1041256	429700	3	136:Membrane Protein	15	0	1	146	0	11
12	DeepTMHMM:outside		outside	275	284			1069203	429700	10025	15	0	1	146	0	12
13	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	282	303			1041259	429700	5	136:Membrane Protein	15	0	1	146	0	13
14	DeepTMHMM:TMhelix		TMhelix	285	303			1069204	429700	2056	141:DeepTMHMM: helix	15	0	1	146	5	14
15	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	303	308			1041262	429700	18	136:Membrane Protein	15	0	1	146	0	15
16	DeepTMHMM:inside		inside	304	308			1069205	429700	9730	15	0	1	146	0	16

↑ Top