Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_000175795.2: Ruminiclostridium papyrosolvens, DSM 2782 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_004616979.1:EIPGKKII_03399
Genome uid: 12
115082-115771 [+] (229)

Sequence:

PIKKVTRQSVSEQVFEQLKEQILNNEWQKGEKIPSENELSALLGVSRVTVRNALQKLISLGLIETRFGEGSFITDALPGI
SMNSLIPIAYLKENSLQEILEYRRVMEGNVAELATKKASPEDVAKLEEAYLAMDKVKDDLEQFSKADLNFHLLLANTTKN
SLIIQTFYIFSDVLNRAFSQIVTKRGNSAGIYYHKLLLEAVKDGNSLEAKRIMDEHMEDLYNTFETNM

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	4	77			429689	7290	42	0	0	1	2084	0	1
2	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	8	77			429685	7290	323	0	0	1	2084	0	2
3	CDD:cd07377	IPR000524	WHTH_GntR	9	75			429687	7290	324	0	0	1	2084	0	3
4	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	11	74	67.8	4.7E-19	429681	7290	322	0	0	1	2084	0	4
5	SMART:SM00345	IPR000524		14	74			429679	7290	1	0	0	1	2084	0	5
6	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	33	48			429678	7290	2145	0	0	1	2084	0	6
7	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	47	64			429677	7290	2145	0	0	1	2084	0	7
8	SUPERFAMILY:SSF48008	IPR008920	Transcription regulator FadR/GntR, C-terminal	95	225			429690	7290	325	0	0	1	2084	0	8
9	SMART:SM00895	IPR011711		98	220			429680	7290	1	0	0	1	2084	0	9
10	PFAM:PF07729	IPR011711	FCD domain	98	219	80.4	1.4E-22	429683	7290	316	0	0	1	2084	0	10

↑ Top