Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_005473905.2: Ruminiclostridium herbifermentans MA18, DSM 109966 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_137696584.1:PROKKA_01401
Genome uid: 208
1701501-1702514 [+] (337)

Sequence:

SNDIINPNLVPQRTLRGGDKMPCIGMGTFGSDRFSAEDIAAAVKGAAEVGFRMFDCASVYGNEHLIGEVFEDIMKSGIRR
EELFITSKVWNDMHGKGDVLLSCAKSLKDLKLDYIDLYFVHWPFRNFHPKGAAPDYHNKDARPFSIEQYMETWYQMERLQ
KAGYVKHIGTSNMTIPKLKELFKYCTIMPAAIEMELHPCFQQPEQFKFVIDHGIQPIGFCPIGSPTRPDRDKTSEDYVDI
QEPVIVEIAKAHNVHPAVICIKWAVQRGQTPIPFSIYRNEYASNIRCVVEDPLTEEEMKKIEGVDKNCRLIKGQVFLWDG
AKDWTDLWDINGEITK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF51430	IPR036812	NADP-dependent oxidoreductase domain superfamily	12	313			2194756	867192	1688	0	0	0	1362	0	1
2	CDD:cd19071		AKR_AKR1-5-like	21	303			2194755	867192	6872	0	0	0	1362	0	2
3	PFAM:PF00248	IPR023210	Aldo/keto reductase family	23	305	164.7	0	2194754	867192	1686	0	0	0	1362	0	3
4	PRINTS:PR00069	IPR020471	Aldo-keto reductase signature	46	71			2194750	867192	3150	0	0	0	1362	0	4
5	PRINTS:PR00069	IPR020471	Aldo-keto reductase signature	105	124			2194753	867192	3150	0	0	0	1362	0	5
6	PRINTS:PR00069	IPR020471	Aldo-keto reductase signature	156	174			2194752	867192	3150	0	0	0	1362	0	6
7	PRINTS:PR00069	IPR020471	Aldo-keto reductase signature	190	220			2194749	867192	3150	0	0	0	1362	0	7
8	PRINTS:PR00069	IPR020471	Aldo-keto reductase signature	239	264			2194751	867192	3150	0	0	0	1362	0	8

↑ Top