We will take the links to it out when ready.
GCF_005473905.2: Ruminiclostridium herbifermentans MA18, DSM 109966 [+] (ncbi)
NIDKTSPIPVYYQLKTILLNKIKSGEYPPGCIIPSERELSEMLGISRMTARQAINQLASEKYLVREKGKGTFVNDAKFEQ RNIMSFSETVKRQGMVPITKVLEFAEETNYDIKEILDLSQEQVLFRIKRLRFADETPIAVEEVFIPKKLCPDINKLDLTK SLYELLKTYYSIDINYMDNKIEAVKASKENRQLLALSAGIPVLKISGISYTKDGDKLFYERDIYRADKYNYSVRIFMGQN
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF46785 | IPR036390 | Winged helix DNA-binding domain superfamily | 3 | 84 | 2203210 | 867699 | 42 | 0 | 0 | 0 | 1869 | 0 | 1 | |||
| 2 | PROSITE_PROFILES:PS50949 | IPR000524 | GntR-type HTH domain profile. | 8 | 77 | 2203207 | 867699 | 323 | 0 | 0 | 0 | 1869 | 0 | 2 | |||
| 3 | CDD:cd07377 | IPR000524 | WHTH_GntR | 9 | 75 | 2203208 | 867699 | 324 | 0 | 0 | 0 | 1869 | 0 | 3 | |||
| 4 | PFAM:PF00392 | IPR000524 | Bacterial regulatory proteins, gntR family | 12 | 74 | 70.4 | 7.2E-20 | 2203205 | 867699 | 322 | 0 | 0 | 0 | 1869 | 0 | 4 | |
| 5 | SMART:SM00345 | IPR000524 | 14 | 74 | 2203203 | 867699 | 1 | 0 | 0 | 0 | 1869 | 0 | 5 | ||||
| 6 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 33 | 48 | 2203202 | 867699 | 2145 | 0 | 0 | 0 | 1869 | 0 | 6 | |||
| 7 | PRINTS:PR00035 | IPR000524 | GntR bacterial regulatory protein HTH signature | 47 | 64 | 2203201 | 867699 | 2145 | 0 | 0 | 0 | 1869 | 0 | 7 | |||
| 8 | SUPERFAMILY:SSF64288 | IPR028978 | Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily | 62 | 235 | 2203209 | 867699 | 2147 | 0 | 0 | 0 | 1869 | 0 | 8 | |||
| 9 | SMART:SM00866 | IPR011663 | 92 | 231 | 2203204 | 867699 | 1 | 0 | 0 | 0 | 1869 | 0 | 9 | ||||
| 10 | PFAM:PF07702 | IPR011663 | UTRA domain | 93 | 230 | 116.5 | 8.1E-34 | 2203206 | 867699 | 2146 | 0 | 0 | 0 | 1869 | 0 | 10 |