Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

GCF_000237085.1: Acetivibrio clariflavus, DSM 19732 [+] (ncbi)

Sequence:

VRAIRGATTVENNDAVEILRETEKLLTEIYEKNKLKEEDLISIIFTVTNDLNATFPAVAARNLGWTSVALMCTNEIPVPG
SLEKCIRVLMHINTDKRNDEIKHIYLNNAKVLRPDIVSD

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF55298	IPR035959	RutC-like superfamily	0	118			328983	91119	1353	0	0	1	1846	0	1
2	PFAM:PF07736	IPR008243	Chorismate mutase type I	1	117	169.3	0	328980	91119	3370	0	0	1	1846	0	2
3	PROSITE_PROFILES:PS51167	IPR008243	Chorismate mutase domain profile.	1	119			328981	91119	3371	0	0	1	1846	0	3
4	CDD:cd02185	IPR008243	AroH	1	117			328982	91119	3372	0	0	1	1846	0	4

↑ Top