Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_001262605.1: Pseudobacteroides cellulosolvens, DSM 2933 [+] (ncbi)

Genbanks info:

Genbank_acc: WP_036943097.1:NEIHKHHH_00746
Genome uid: 17
838499-840121 [+] (540)

Sequence:

NIFIGGAWPYANGSLHIGHIAALLPGDVLARYYRLKGHSVCYVSGSDCHGTPIQIRANKEGVSPKEISNYYHNEFKSCFD
KLGFTFDLYNQTNDYFHSSFVQEFFAKLLDSGYIYKKTVEQAFCQKCNQFLPDRFVVGKCPNCGSIAKGDQCDSCGSLLD
PSNLNDRRCGICGESPICKPSEHFFLALSKLEPFIKKYINCSSGWRANAISLSQRYIDEGLRDRAVTRDLEWGIPIPVEG
FETKKIYVWVEAVLGYLSASKKWVFANNLNWESLWADNSLHYYIHGKDNIPFHTIILPALLKAHGNLHLPDKIISSEYVT
LEGRKISTSQNWAVWIPYLLESYNPDTIRYFFISNGPEKRDIDFSWREFINSHNGELLGAYGNLVNRSLVFINKSFDSKV
PEGQCNPNIRKLLTELYLGVGNLIEQGNFKDALETIFSFIRSANKYFDEEQPWVTVKDNIVKCKETLHTCVQIIANLSIL
LNPFLPVSSDKVKNMLKIETNGWEYIEVPSDSRIGNVTILFERIDKNRIDEELEKLKKL

metG

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	CDD:cd00814	IPR033911	MetRS_core	1	365			575705	92236	1805	0	0	1	737	0	1
2	PFAM:PF09334	IPR015413	tRNA synthetases class I (M)	3	389	462.8	0	575702	92236	1798	0	0	1	737	0	2
3	SUPERFAMILY:SSF52374		-	3	376			575706	92236	12	0	0	1	737	0	3
4	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	4	18			575700	92236	1797	0	0	1	737	0	4
5	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	36	51			575701	92236	1797	0	0	1	737	0	5
6	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	84	96			575697	92236	1797	0	0	1	737	0	6
7	SUPERFAMILY:SSF57770	IPR029038	Methionyl-tRNA synthetase, Zn-domain	131	157			575708	92236	5913	0	0	1	737	0	7
8	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	246	258			575698	92236	1797	0	0	1	737	0	8
9	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	283	299			575696	92236	1797	0	0	1	737	0	9
10	CDD:cd07957	IPR041872	Anticodon_Ia_Met	373	497			575704	92236	1807	0	0	1	737	0	10
11	PRINTS:PR01041	IPR033911	Methionyl-tRNA synthetase signature	376	388			575699	92236	1797	0	0	1	737	0	11
12	SUPERFAMILY:SSF47323	IPR009080	Aminoacyl-tRNA synthetase, class Ia, anticodon-binding	381	538			575707	92236	726	0	0	1	737	0	12
13	PFAM:PF19303	IPR041872	Anticodon binding domain of methionyl tRNA ligase	424	506	31.5	1.4E-7	575703	92236	1803	0	0	1	737	0	13

↑ Top