We will take the links to it out when ready.
GCF_003208175.1: Ruminiclostridium sufflavum, DSM 19573 [+] (ncbi)
PVRSIRGAITVAENTKKSILEGTHELLVEIIKRNGLDSEDIISVIFSVTHDLNAAFPAVAAREIGWKDISLMCTNEINVP DSLKSCIRVLIHFNTEKANNEINHVYLKGAKILRPDISAGG
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF55298 | IPR035959 | RutC-like superfamily | 1 | 119 | 966989 | 93856 | 1353 | 0 | 0 | 1 | 1908 | 0 | 1 | |||
| 2 | PFAM:PF07736 | IPR008243 | Chorismate mutase type I | 2 | 118 | 165.6 | 0 | 966986 | 93856 | 3370 | 0 | 0 | 1 | 1908 | 0 | 2 | |
| 3 | PROSITE_PROFILES:PS51167 | IPR008243 | Chorismate mutase domain profile. | 2 | 120 | 966987 | 93856 | 3371 | 0 | 0 | 1 | 1908 | 0 | 3 | |||
| 4 | CDD:cd02185 | IPR008243 | AroH | 2 | 118 | 966988 | 93856 | 3372 | 0 | 0 | 1 | 1908 | 0 | 4 |