Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00057
Genome uid: 222
44396-45628 [+] (410)

Sequence:

SQKSYLVYLLLLTVACLFFTAPSTARADTLPADTISAQAYVLMDADSGKLLASKNPHRRLPPASMTKLMTLLLTLEALDE
GEADKNDQVVSSKYACSMEGTSIYLEPGEIMTLDDMIKGMTLASANDASVAVAEYLADSETAFVEEMNQKAREIGMKDTF
FKNVNGLPADGHYSSAYDMALLAKYTLANTSITDYTSLKQHNLRQGEYVISNSNRLLWRYAGADGLKTGYTSEAKNCLVA
TAKRDNLRLIVVVMGCPMRGGHTQDAMTLLDYGFDHYSAMHIIDKGTVCGTVKVRGGVVKQVEAVVAEEINAIYPKIRGG
SFSRHQELDSRLKAPVKRGQKVGETLIFEDGKLLKKVDLLAANDVPRLNLAGRVGQIPWGFKVFIAFIIAVSYIRNRRIK
LHKNRVRKF

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	22			2033537	941299	3	136:Membrane Protein	0	0	1	56	0	1
2	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	6			2726552	941299	21	135:all secretion /signal peptide, lipo	0	0	0	56	3	2
3	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	28			2726554	941299	19	135:all secretion /signal peptide, lipo	0	0	0	56	3	3
4	PROSITE_PROFILES:PS51898	IPR002104	Tyrosine recombinase domain profile.	0	108			2417873	941299	1666	0	0	0	56	0	4
5	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	27			620250	941299	18	136:Membrane Protein	0	0	1	56	0	5
6	PROSITE_PROFILES:PS51257		Prokaryotic membrane lipoprotein lipid attachment site profile.	0	17			2726558	941299	54	135:all secretion /signal peptide, lipo	0	0	0	56	3	6
7	DeepTMHMM:outside		outside	1	1			661281	941299	10025	0	0	1	56	0	7
8	DeepTMHMM:inside		inside	1	22			2023928	941299	9730	0	0	1	56	0	8
9	SUPERFAMILY:SSF56349	IPR011010	DNA breaking-rejoining enzyme, catalytic core	1	105			2417874	941299	1669	0	0	0	56	0	9
10	DeepTMHMM:TMhelix		TMhelix	2	12			661282	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	10
11	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	4	85			2697905	941299	657	0	0	0	56	0	11
12	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	6	20			2726556	941299	24	135:all secretion /signal peptide, lipo	0	0	0	56	3	12
13	SUPERFAMILY:SSF56601	IPR012338	Beta-lactamase/transpeptidase-like	8	278			2726559	941299	558	0	0	0	56	0	13
14	PROSITE_PROFILES:PS50977	IPR001647	TetR-type HTH domain profile.	9	70			2697903	941299	704	0	0	0	56	0	14
15	DeepTMHMM:inside		inside	13	25			661283	941299	9730	0	0	1	56	0	15
16	PFAM:PF00849	IPR006145	RNA pseudouridylate synthase	13	138	52.5	5.9E-14	870122	941299	191	0	0	1	56	0	16
17	PRINTS:PR00455	IPR001647	TetR bacterial regulatory protein HTH signature	15	29			2697900	941299	1226	0	0	0	56	0	17
18	PFAM:PF00440	IPR001647	Bacterial regulatory proteins, tetR family	16	60	46.7	2.0E-12	2697902	941299	702	0	0	0	56	0	18
19	SUPERFAMILY:SSF55120	IPR020103	Pseudouridine synthase, catalytic domain superfamily	17	165			870123	941299	193	0	0	1	56	0	19
20	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	20	28			2726555	941299	26	135:all secretion /signal peptide, lipo	0	0	0	56	3	20
21	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	22	41			2033506	941299	5	136:Membrane Protein	0	0	1	56	0	21
22	DeepTMHMM:TMhelix		TMhelix	23	39			2023929	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	22
23	DeepTMHMM:TMhelix		TMhelix	26	46			661284	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	23
24	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	27	46			620247	941299	5	136:Membrane Protein	0	0	1	56	0	24
25	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	28	377			2726553	941299	3	136:Membrane Protein	0	0	0	56	0	25
26	SIGNALP6:SP		SP	28	29	0		2741815	941299	1978	135:all secretion /signal peptide, lipo	0	0	0	56	3	26
27	PFAM:PF00589	IPR002104	Phage integrase family	31	99	41.6	1.1E-10	2417872	941299	1665	0	0	0	56	0	27
28	PFAM:PF00768	IPR001967	D-alanyl-D-alanine carboxypeptidase	32	257	248.5	0	2726550	941299	555	0	0	0	56	0	28
29	PRINTS:PR00455	IPR001647	TetR bacterial regulatory protein HTH signature	36	60			2697901	941299	1226	0	0	0	56	0	29
30	DeepTMHMM:outside		outside	40	52			2023930	941299	10025	0	0	1	56	0	30
31	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	41	52			2033522	941299	18	136:Membrane Protein	0	0	1	56	0	31
32	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	46	51			620246	941299	3	136:Membrane Protein	0	0	1	56	0	32
33	CDD:cd00268		DEADc	46	238			2661172	941299	3847	0	0	0	56	0	33
34	DeepTMHMM:outside		outside	47	49			661286	941299	10025	0	0	1	56	0	34
35	DeepTMHMM:TMhelix		TMhelix	50	70			661288	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	35
36	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	51	71			620248	941299	5	136:Membrane Protein	0	0	1	56	0	36
37	PFAM:PF02653	IPR001851	Branched-chain amino acid transport system / permease component	52	317	132.1	2.0E-38	2033502	941299	154	0	0	1	56	0	37
38	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	52	72			2033520	941299	5	136:Membrane Protein	0	0	1	56	0	38
39	DeepTMHMM:TMhelix		TMhelix	53	71			2023931	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	39
40	SMART:SM00487	IPR014001		54	247			2661167	941299	1	0	0	0	56	0	40
41	CDD:cd06579		TM_PBP1_transp_AraH_like	57	321			2033546	941299	160	0	0	1	56	0	41
42	PFAM:PF00270	IPR011545	DEAD/DEAH box helicase	60	223	143.2	6.99949E-42	2661168	941299	2167	0	0	0	56	0	42
43	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	63	75			2726545	941299	554	0	0	0	56	0	43
44	PROSITE_PROFILES:PS51192	IPR014001	Superfamilies 1 and 2 helicase ATP-binding type-1 domain profile.	66	237			2661170	941299	487	0	0	0	56	0	44
45	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	71	73			620249	941299	18	136:Membrane Protein	0	0	1	56	0	45
46	DeepTMHMM:inside		inside	71	73			661372	941299	9730	0	0	1	56	0	46
47	DeepTMHMM:inside		inside	72	79			2023932	941299	9730	0	0	1	56	0	47
48	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	72	77			2033532	941299	3	136:Membrane Protein	0	0	1	56	0	48
49	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	77	96			2033518	941299	5	136:Membrane Protein	0	0	1	56	0	49
50	DeepTMHMM:TMhelix		TMhelix	80	95			2023933	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	50
51	SUPERFAMILY:SSF48498	IPR036271	Tetracyclin repressor-like, C-terminal domain superfamily	94	189			2697904	941299	1227	0	0	0	56	0	51
52	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	96	102			2033523	941299	18	136:Membrane Protein	0	0	1	56	0	52
53	DeepTMHMM:outside		outside	96	102			2023934	941299	10025	0	0	1	56	0	53
54	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	102	127			2033514	941299	5	136:Membrane Protein	0	0	1	56	0	54
55	DeepTMHMM:TMhelix		TMhelix	103	124			2023935	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	55
56	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	105	388			2661174	941299	78	0	0	0	56	0	56
57	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	116	134			2726546	941299	554	0	0	0	56	0	57
58	DeepTMHMM:inside		inside	125	133			2023936	941299	9730	0	0	1	56	0	58
59	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	127	132			2033543	941299	3	136:Membrane Protein	0	0	1	56	0	59
60	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	132	152			2033504	941299	5	136:Membrane Protein	0	0	1	56	0	60
61	DeepTMHMM:TMhelix		TMhelix	134	143			2024171	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	61
62	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	143	157			2726547	941299	554	0	0	0	56	0	62
63	DeepTMHMM:outside		outside	144	177			2024173	941299	10025	0	0	1	56	0	63
64	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	152	172			2033529	941299	18	136:Membrane Protein	0	0	1	56	0	64
65	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	172	194			2033512	941299	5	136:Membrane Protein	0	0	1	56	0	65
66	DeepTMHMM:TMhelix		TMhelix	178	193			2024174	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	66
67	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	194	223			2033540	941299	3	136:Membrane Protein	0	0	1	56	0	67
68	DeepTMHMM:inside		inside	194	223			2024176	941299	9730	0	0	1	56	0	68
69	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	223	244			2033510	941299	5	136:Membrane Protein	0	0	1	56	0	69
70	DeepTMHMM:TMhelix		TMhelix	224	244			2024178	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	70
71	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	244	264			2033526	941299	18	136:Membrane Protein	0	0	1	56	0	71
72	DeepTMHMM:outside		outside	245	258			2024180	941299	10025	0	0	1	56	0	72
73	CDD:cd18787		SF2_C_DEAD	249	378			2661173	941299	3848	0	0	0	56	0	73
74	DeepTMHMM:TMhelix		TMhelix	259	272			2024182	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	74
75	PROSITE_PROFILES:PS51194	IPR001650	Superfamilies 1 and 2 helicase C-terminal domain profile.	263	409			2661171	941299	1121	0	0	0	56	0	75
76	PFAM:PF00271	IPR001650	Helicase conserved C-terminal domain	263	369	100.9	4.9E-29	2661169	941299	1120	0	0	0	56	0	76
77	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	264	292			2033516	941299	5	136:Membrane Protein	0	0	1	56	0	77
78	SUPERFAMILY:SSF69189	IPR015956	Penicillin-binding protein, C-terminal domain superfamily	269	366			2726560	941299	557	0	0	0	56	0	78
79	DeepTMHMM:inside		inside	273	279			2024183	941299	9730	0	0	1	56	0	79
80	PFAM:PF07943	IPR012907	Penicillin-binding protein 5, C-terminal domain	277	368	50.8	1.5E-13	2726549	941299	556	0	0	0	56	0	80
81	SMART:SM00936	IPR012907		277	368			2726548	941299	1	0	0	0	56	0	81
82	DeepTMHMM:TMhelix		TMhelix	280	292			2024185	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	82
83	SMART:SM00490	IPR001650		287	369			2661166	941299	1	0	0	0	56	0	83
84	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	292	303			2033535	941299	3	136:Membrane Protein	0	0	1	56	0	84
85	DeepTMHMM:outside		outside	293	307			2024187	941299	10025	0	0	1	56	0	85
86	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	303	324			2033508	941299	5	136:Membrane Protein	0	0	1	56	0	86
87	DeepTMHMM:TMhelix		TMhelix	308	321			2024188	941299	2056	141:DeepTMHMM: helix	0	0	1	56	6	87
88	DeepTMHMM:inside		inside	322	340			2024189	941299	9730	0	0	1	56	0	88
89	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	324	340			2033525	941299	18	136:Membrane Protein	0	0	1	56	0	89
90	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	377	396			2726557	941299	5	136:Membrane Protein	0	0	0	56	0	90
91	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	396	410			2726551	941299	18	136:Membrane Protein	0	0	0	56	0	91

↑ Top