Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00265
Genome uid: 222
260511-260747 [+] (78)

Sequence:

KTGLVFLSVGVILIFYAYWAYRKADCNLSKTKEEDLVSYYLDLALKLYPGALWSALLGIFFTIIALVIIVINLPLIF

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	4			2731534	941506	18	136:Membrane Protein	0	0	0	263	0	1
2	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			742454	941506	18	136:Membrane Protein	15	0	1	263	0	2
3	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	20			2700527	941506	18	136:Membrane Protein	0	0	0	263	0	3
4	DeepTMHMM:inside		inside	1	24			2713159	941506	9730	0	0	0	263	0	4
5	DeepTMHMM:inside		inside	1	8			777818	941506	9730	15	0	1	263	0	5
6	SUPERFAMILY:SSF52317	IPR029062	Class I glutamine amidotransferase-like	3	198			1356426	941506	798	15	0	1	263	0	6
7	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	4	22			2731530	941506	5	136:Membrane Protein	0	0	0	263	0	7
8	CDD:cd03146	IPR005320	GAT1_Peptidase_E	4	214			1356425	941506	6078	15	0	1	263	0	8
9	PFAM:PF03575	IPR005320	Peptidase family S51	4	198	140.8	4.60004E-41	1356424	941506	1278	15	0	1	263	0	9
10	DeepTMHMM:TMhelix		TMhelix	9	29			777819	941506	2056	141:DeepTMHMM: helix	15	0	1	263	6	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	33			742443	941506	5	136:Membrane Protein	15	0	1	263	0	11
12	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	20	46			2700524	941506	5	136:Membrane Protein	0	0	0	263	0	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	22	51			2731532	941506	3	136:Membrane Protein	0	0	0	263	0	13
14	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	24	96			1715128	941506	42	15	0	1	263	0	14
15	DeepTMHMM:TMhelix		TMhelix	25	46			2713160	941506	2056	141:DeepTMHMM: helix	0	0	0	263	6	15
16	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	27	95			1715126	941506	323	15	0	1	263	0	16
17	CDD:cd07377	IPR000524	WHTH_GntR	28	93			1715127	941506	324	15	0	1	263	0	17
18	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	29	92	49.9	1.8E-13	1715125	941506	322	15	0	1	263	0	18
19	DeepTMHMM:outside		outside	30	38			777820	941506	10025	15	0	1	263	0	19
20	SMART:SM00345	IPR000524		33	92			1715119	941506	1	15	0	1	263	0	20
21	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	33	38			742458	941506	3	136:Membrane Protein	15	0	1	263	0	21
22	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	38	62			742441	941506	5	136:Membrane Protein	15	0	1	263	0	22
23	DeepTMHMM:TMhelix		TMhelix	39	58			777821	941506	2056	141:DeepTMHMM: helix	15	0	1	263	6	23
24	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	46	170			2700526	941506	3	136:Membrane Protein	0	0	0	263	0	24
25	PFAM:PF03721	IPR001732	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain	46	213	39.7	3.5E-10	1598827	941506	2185	15	0	1	263	0	25
26	SUPERFAMILY:SSF51735	IPR036291	NAD(P)-binding domain superfamily	46	222			1598829	941506	206	15	0	1	263	0	26
27	DeepTMHMM:outside		outside	47	167			2713161	941506	10025	0	0	0	263	0	27
28	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	51	76			2731531	941506	5	136:Membrane Protein	0	0	0	263	0	28
29	PFAM:PF18075	IPR040690	FtsX extracellular domain	58	152	85.2	3.7E-24	2700520	941506	1672	0	0	0	263	0	29
30	DeepTMHMM:inside		inside	59	92			777822	941506	9730	15	0	1	263	0	30
31	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	62	92			742452	941506	18	136:Membrane Protein	15	0	1	263	0	31
32	SUPERFAMILY:SSF51306	IPR036286	LexA/Signal peptidase-like superfamily	69	191			2667639	941506	22	135:all secretion /signal peptide, lipo	0	0	0	263	3	32
33	PFAM:PF00717	IPR015927	Peptidase S24-like	72	186	96.1	1.1E-27	2667637	941506	1409	0	0	0	263	0	33
34	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	76	78			2731533	941506	18	136:Membrane Protein	0	0	0	263	0	34
35	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	92	111			742450	941506	5	136:Membrane Protein	15	0	1	263	0	35
36	DeepTMHMM:TMhelix		TMhelix	93	108			777823	941506	2056	141:DeepTMHMM: helix	15	0	1	263	6	36
37	SUPERFAMILY:SSF48008	IPR008920	Transcription regulator FadR/GntR, C-terminal	96	232			1715129	941506	325	15	0	1	263	0	37
38	SMART:SM00895	IPR011711		101	224			1715121	941506	1	15	0	1	263	0	38
39	PFAM:PF07729	IPR011711	FCD domain	101	223	58.3	1.0E-15	1715123	941506	316	15	0	1	263	0	39
40	CDD:cd06529	IPR039418	S24_LexA-like	107	187			2667638	941506	2345	0	0	0	263	0	40
41	PRINTS:PR00726	IPR006197	Repressor LexA serine protease (S24) family signature	107	118			2667635	941506	2344	0	0	0	263	0	41
42	DeepTMHMM:outside		outside	109	112			777824	941506	10025	15	0	1	263	0	42
43	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	111	112			742459	941506	3	136:Membrane Protein	15	0	1	263	0	43
44	PRINTS:PR00726	IPR006197	Repressor LexA serine protease (S24) family signature	118	130			2667636	941506	2344	0	0	0	263	0	44
45	PRINTS:PR00726	IPR006197	Repressor LexA serine protease (S24) family signature	146	159			2667634	941506	2344	0	0	0	263	0	45
46	DeepTMHMM:TMhelix		TMhelix	168	188			2713162	941506	2056	141:DeepTMHMM: helix	0	0	0	263	6	46
47	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	170	197			2700522	941506	5	136:Membrane Protein	0	0	0	263	0	47
48	PFAM:PF02687	IPR003838	FtsX-like permease family	174	291	42.6	5.1E-11	2700519	941506	195	0	0	0	263	0	48
49	SUPERFAMILY:SSF52402		-	181	335			1038917	941506	12	15	0	1	263	0	49
50	DeepTMHMM:inside		inside	189	224			2713163	941506	9730	0	0	0	263	0	50
51	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	197	217			2700529	941506	18	136:Membrane Protein	0	0	0	263	0	51
52	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	217	244			2700523	941506	5	136:Membrane Protein	0	0	0	263	0	52
53	DeepTMHMM:TMhelix		TMhelix	225	242			2713164	941506	2056	141:DeepTMHMM: helix	0	0	0	263	6	53
54	SUPERFAMILY:SSF48179	IPR008927	6-phosphogluconate dehydrogenase-like, C-terminal domain superfamily	231	323			1598830	941506	1085	15	0	1	263	0	54
55	PFAM:PF00984	IPR014026	UDP-glucose/GDP-mannose dehydrogenase family, central domain	231	316	44.5	1.3E-11	1598825	941506	2186	15	0	1	263	0	55
56	DeepTMHMM:outside		outside	243	267			2713165	941506	10025	0	0	0	263	0	56
57	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	244	263			2700525	941506	3	136:Membrane Protein	0	0	0	263	0	57
58	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	263	288			2700521	941506	5	136:Membrane Protein	0	0	0	263	0	58
59	DeepTMHMM:TMhelix		TMhelix	268	286			2713166	941506	2056	141:DeepTMHMM: helix	0	0	0	263	6	59
60	DeepTMHMM:inside		inside	287	294			2713167	941506	9730	0	0	0	263	0	60
61	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	288	294			2700528	941506	18	136:Membrane Protein	0	0	0	263	0	61
62	SUPERFAMILY:SSF52413	IPR036220	UDP-glucose/GDP-mannose dehydrogenase, C-terminal domain superfamily	327	436			1598828	941506	2188	15	0	1	263	0	62
63	SMART:SM00984	IPR014027		333	432			1598824	941506	1	15	0	1	263	0	63
64	PFAM:PF03720	IPR014027	UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain	334	414	44.8	1.4E-11	1598826	941506	2187	15	0	1	263	0	64

↑ Top