Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00277
Genome uid: 222
269623-269973 [+] (116)

Sequence:

KKIAVCATGENPESKVDGRFGRCNYFIINHFNGDQYTSLVNSGVNANQGAGIGTAQTLVKEGVNVVVTNRIGPKAFKVLK
AAGIKMYAAEADQTVAMAVKEYYEGKLPEINSPNN

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	742			1177506	941518	3	136:Membrane Protein	15	0	1	275	0	1
2	SUPERFAMILY:SSF53146	IPR036105	Dinitrogenase iron-molybdenum cofactor biosynthesis superfamily	1	115			2739994	941518	2406	0	0	0	275	0	2
3	DeepTMHMM:outside		outside	1	743			1202613	941518	10025	15	0	1	275	0	3
4	CDD:cd00851	IPR033913	MTH1175	2	103			2739993	941518	3832	0	0	0	275	0	4
5	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	3	53			1963000	941518	657	15	0	1	275	0	5
6	PROSITE_PROFILES:PS01124	IPR018060	Bacterial regulatory proteins, araC family DNA-binding domain profile.	5	103			1962997	941518	1337	15	0	1	275	0	6
7	PFAM:PF00749	IPR020058	tRNA synthetases class I (E and Q), catalytic domain	5	307	353.3	0	2664252	941518	872	0	0	0	275	0	7
8	SUPERFAMILY:SSF52374		-	5	300			2664256	941518	12	0	0	0	275	0	8
9	CDD:cd00808	IPR033910	GluRS_core	6	315			2664254	941518	4716	0	0	0	275	0	9
10	PRINTS:PR00987	IPR000924	Glutamyl-tRNA synthetase signature	9	22			2664249	941518	870	0	0	0	275	0	10
11	PFAM:PF02579	IPR003731	Dinitrogenase iron-molybdenum cofactor	13	104	76.3	1.7E-21	2739992	941518	2404	0	0	0	275	0	11
12	PFAM:PF07494	IPR011110	Two component regulator propeller	15	39	16.8	0.0054	1177447	941518	6030	15	0	1	275	0	12
13	SMART:SM00342	IPR018060		18	101			1962992	941518	1	15	0	1	275	0	13
14	PRINTS:PR00987	IPR000924	Glutamyl-tRNA synthetase signature	23	35			2664251	941518	870	0	0	0	275	0	14
15	PFAM:PF12833	IPR018060	Helix-turn-helix domain	24	102	59.6	2.6E-16	1962995	941518	1014	15	0	1	275	0	15
16	PROSITE_PROFILES:PS51464	IPR001347	SIS domain profile.	26	166			2707431	941518	2607	0	0	0	275	0	16
17	PFAM:PF01380	IPR001347	SIS domain	36	113	25.5	9.4E-6	2707429	941518	2605	0	0	0	275	0	17
18	CDD:cd05017	IPR035484	SIS_PGI_PMI_1	36	155			2707433	941518	8385	0	0	0	275	0	18
19	PRINTS:PR00987	IPR000924	Glutamyl-tRNA synthetase signature	38	52			2664247	941518	870	0	0	0	275	0	19
20	SUPERFAMILY:SSF53697	IPR046348	SIS domain superfamily	43	332			2707434	941518	997	0	0	0	275	0	20
21	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	54	105			1962999	941518	657	15	0	1	275	0	21
22	SUPERFAMILY:SSF55136	IPR011256	Regulatory factor, effector binding domain superfamily	124	287			1963021	941518	2556	15	0	1	275	0	22
23	PFAM:PF06445	IPR029442	GyrI-like small molecule binding domain	124	285	71.5	9.9E-20	1962993	941518	2555	15	0	1	275	0	23
24	SMART:SM00871	IPR010499		124	286			1962991	941518	1	15	0	1	275	0	24
25	PRINTS:PR00987	IPR000924	Glutamyl-tRNA synthetase signature	180	191			2664250	941518	870	0	0	0	275	0	25
26	SUPERFAMILY:SSF63829		-	184	385			1177510	941518	12	15	0	1	275	0	26
27	PFAM:PF10432	IPR019490	Bacterial phospho-glucose isomerase C-terminal SIS domain	186	338	191.4	0	2707430	941518	8383	0	0	0	275	0	27
28	CDD:cd05637	IPR019490	SIS_PGI_PMI_2	188	325			2707432	941518	8384	0	0	0	275	0	28
29	PRINTS:PR00987	IPR000924	Glutamyl-tRNA synthetase signature	196	205			2664248	941518	870	0	0	0	275	0	29
30	SUPERFAMILY:SSF48163	IPR008925	Aminoacyl-tRNA synthetase, class I, anticodon-binding superfamily	300	463			2664255	941518	1795	0	0	0	275	0	30
31	PFAM:PF19269	IPR045462	Anticodon binding domain	320	462	116.6	1.1E-33	2664253	941518	379	0	0	0	275	0	31
32	SUPERFAMILY:SSF63829		-	416	610			1177512	941518	12	15	0	1	275	0	32
33	PFAM:PF07494	IPR011110	Two component regulator propeller	539	561	16.8	0.0056	1177449	941518	6030	15	0	1	275	0	33
34	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	742	764			1177505	941518	5	136:Membrane Protein	15	0	1	275	0	34
35	DeepTMHMM:TMhelix		TMhelix	744	764			1202614	941518	2056	141:DeepTMHMM: helix	15	0	1	275	6	35
36	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	764	991			1177453	941518	18	136:Membrane Protein	15	0	1	275	0	36
37	DeepTMHMM:inside		inside	765	991			1202615	941518	9730	15	0	1	275	0	37
38	PFAM:PF06580	IPR010559	Histidine kinase	787	862	65.8	3.2E-18	1177451	941518	1640	15	0	1	275	0	38
39	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	859	960			1177508	941518	122	15	0	1	275	0	39

↑ Top