Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00671
Genome uid: 222
709301-709738 [+] (145)

Sequence:

ITNLEEIIKDLQQAMGDNIEISADNVFTWVRTSPNNLIALLSKLKDEYGFNYLANLTSVDFPDRFEIIYHIYSIPDNRKI
GVKTSVDKNKAEIPSAASIWLTADWQEREVYDLMGIRFSGHPNLIRILLPDDFEGHPLRKDFQW

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	37			1632956	941900	18	136:Membrane Protein	0	0	1	657	0	1
2	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	0	62			1425027	941900	42	0	0	1	657	0	2
3	PFAM:PF07963	IPR012902	Prokaryotic N-terminal methylation motif	0	27	34.3	1.0E-8	501730	941900	2950	0	0	1	657	0	3
4	PROSITE_PROFILES:PS50944	IPR022687	DtxR-type HTH domain profile.	0	63			1425025	941900	2294	0	0	1	657	0	4
5	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	11			501734	941900	21	135:all secretion /signal peptide, lipo	0	0	1	657	3	5
6	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	27			1963714	941900	3	136:Membrane Protein	0	0	1	657	0	6
7	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	32			501736	941900	19	135:all secretion /signal peptide, lipo	0	0	1	657	3	7
8	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	14			831612	941900	3	136:Membrane Protein	0	0	1	657	0	8
9	DeepTMHMM:inside		inside	1	13			462724	941900	9730	0	0	1	657	0	9
10	PFAM:PF01325	IPR022687	Iron dependent repressor, N-terminal DNA binding domain	1	60	64.7	6.2E-18	1425023	941900	2293	0	0	1	657	0	10
11	DeepTMHMM:inside		inside	1	37			1635712	941900	9730	0	0	1	657	0	11
12	DeepTMHMM:inside		inside	1	27			2019496	941900	9730	0	0	1	657	0	12
13	SUPERFAMILY:SSF53448	IPR029044	Nucleotide-diphospho-sugar transferases	1	268			2666388	941900	753	0	0	0	657	0	13
14	PFAM:PF02452	IPR003477	PemK-like, MazF-like toxin of type II toxin-antitoxin system	5	111	86.6	1.3E-24	2697618	941900	1134	0	0	0	657	0	14
15	SUPERFAMILY:SSF50118		-	5	116			2697619	941900	12	0	0	0	657	0	15
16	SIGNALP6:PILIN		PILIN	6	7	0		527217	941900	2004	135:all secretion /signal peptide, lipo	0	0	1	657	0	16
17	SUPERFAMILY:SSF54523	IPR045584	Pilin-like	6	109			501737	941900	2951	0	0	1	657	0	17
18	PFAM:PF00535	IPR001173	Glycosyl transferase family 2	7	114	96.9	1.1E-27	2666386	941900	751	0	0	0	657	0	18
19	CDD:cd00761		Glyco_tranf_GTA_type	8	132			2666387	941900	1893	0	0	0	657	0	19
20	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	11	27			501735	941900	24	135:all secretion /signal peptide, lipo	0	0	1	657	3	20
21	SUPERFAMILY:SSF143243	IPR037232	NADH:ubiquinone oxidoreductase, 30kDa subunit superfamily	11	144			2740744	941900	374	0	0	0	657	0	21
22	DeepTMHMM:TMhelix		TMhelix	14	27			462725	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	22
23	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	14	35			831608	941900	5	136:Membrane Protein	0	0	1	657	0	23
24	SMART:SM00529	IPR022689		23	123			1425017	941900	1	0	0	1	657	0	24
25	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	27	32			501733	941900	26	135:all secretion /signal peptide, lipo	0	0	1	657	3	25
26	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	27	46			1963715	941900	5	136:Membrane Protein	0	0	1	657	0	26
27	DeepTMHMM:outside		outside	28	314			462726	941900	10025	0	0	1	657	0	27
28	DeepTMHMM:TMhelix		TMhelix	28	45			2019497	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	28
29	PFAM:PF07596	IPR011453	Protein of unknown function (DUF1559)	30	296	202	0	501731	941900	11535	0	0	1	657	0	29
30	PFAM:PF00329	IPR001268	Respiratory-chain NADH dehydrogenase, 30 Kd subunit	32	144	141.1	2.59997E-41	2740743	941900	373	0	0	0	657	0	30
31	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	32	314			501732	941900	3	136:Membrane Protein	0	0	1	657	0	31
32	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	35	51			831610	941900	18	136:Membrane Protein	0	0	1	657	0	32
33	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	37	58			1632949	941900	5	136:Membrane Protein	0	0	1	657	0	33
34	DeepTMHMM:TMhelix		TMhelix	38	53			1635713	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	34
35	PFAM:PF07331	IPR009936	Tripartite tricarboxylate transporter TctB family	40	183	76.9	1.8E-21	1632948	941900	10832	0	0	1	657	0	35
36	DeepTMHMM:outside		outside	46	53			2019498	941900	10025	0	0	1	657	0	36
37	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	46	53			1963716	941900	18	136:Membrane Protein	0	0	1	657	0	37
38	DeepTMHMM:outside		outside	54	72			1635714	941900	10025	0	0	1	657	0	38
39	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	58	72			1632958	941900	3	136:Membrane Protein	0	0	1	657	0	39
40	SUPERFAMILY:SSF47979	IPR036421	Iron dependent repressor, metal binding and dimerisation domain superfamily	63	136			1425029	941900	2295	0	0	1	657	0	40
41	PFAM:PF02742	IPR001367	Iron dependent repressor, metal binding and dimerisation domain	64	132	97.4	3.7E-28	1425021	941900	2292	0	0	1	657	0	41
42	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	72	93			1632950	941900	5	136:Membrane Protein	0	0	1	657	0	42
43	DeepTMHMM:TMhelix		TMhelix	73	90			1635715	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	43
44	PFAM:PF06545	IPR009499	Protein of unknown function (DUF1116)	81	287	139.1	1.4E-40	1655062	941900	10287	0	0	1	657	0	44
45	DeepTMHMM:inside		inside	91	113			1635716	941900	9730	0	0	1	657	0	45
46	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	93	113			1632955	941900	18	136:Membrane Protein	0	0	1	657	0	46
47	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	113	131			1632951	941900	5	136:Membrane Protein	0	0	1	657	0	47
48	DeepTMHMM:TMhelix		TMhelix	114	131			1635717	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	48
49	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	131	136			1632957	941900	3	136:Membrane Protein	0	0	1	657	0	49
50	DeepTMHMM:outside		outside	132	132			1635718	941900	10025	0	0	1	657	0	50
51	DeepTMHMM:TMhelix		TMhelix	133	151			1635719	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	51
52	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	136	154			1632953	941900	5	136:Membrane Protein	0	0	1	657	0	52
53	PFAM:PF04023	IPR007167	FeoA domain	143	215	31.7	1.2E-7	1425019	941900	620	0	0	1	657	0	53
54	DeepTMHMM:inside		inside	152	159			1635721	941900	9730	0	0	1	657	0	54
55	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	154	160			1632954	941900	18	136:Membrane Protein	0	0	1	657	0	55
56	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	160	182			1632952	941900	5	136:Membrane Protein	0	0	1	657	0	56
57	DeepTMHMM:TMhelix		TMhelix	160	178			1635723	941900	2056	141:DeepTMHMM: helix	0	0	1	657	6	57
58	DeepTMHMM:outside		outside	179	191			1635724	941900	10025	0	0	1	657	0	58
59	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	182	191			1632959	941900	3	136:Membrane Protein	0	0	1	657	0	59

↑ Top