Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00751
Genome uid: 222
788989-790254 [+] (421)

Sequence:

FVDHARIFVRGGDGGNGIVAFRREKYVPMGGPAGGDGGRGGNVIFVADEGLNTLMDFRYNRHFKAPRGQHGQGKNMHGAG
GEDLLVKVPVGTVIKDDDNGEVLADLVESGQQVIVARGGRGGRGNARFSTARNRAPSISENGEPGEERWVRLELKLLADV
GLVGFPNAGKSTFISRISAARPKIADYPFTTLVPNLGVVVTPAHDSFVVADIPGLIEGAHLGSGLGHDFLRHIERTRVLL
FVLDVAETEGRDCREDYHILRRELENFNPDLALRPYLIVANKMDIPGAEDNLPKLQSEFGDKVYPISAVTSQGVDHLIQK
TYQILSTLPRETFIQGEEPVIHRFEEEEEPFSIEMVAGVYEVKGKRIEKLVAMTNFGTEDGVRRFQHIVQKMGLEEALRK
KGIKPGDTVRIMELEFDYSE

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF82051	IPR036726	GTP1/OBG domain superfamily	0	157			2735030	941975	1911	0	0	0	732	0	1
2	PROSITE_PROFILES:PS51883	IPR006169	Obg domain profile.	0	158			2735026	941975	1907	0	0	0	732	0	2
3	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	6			953064	941975	21	135:all secretion /signal peptide, lipo	15	0	1	732	3	3
4	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	23			953066	941975	19	135:all secretion /signal peptide, lipo	15	0	1	732	3	4
5	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	3			1023517	941975	21	135:all secretion /signal peptide, lipo	15	0	1	732	3	5
6	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	22			1023512	941975	19	135:all secretion /signal peptide, lipo	15	0	1	732	3	6
7	DeepTMHMM:inside		inside	1	6			939558	941975	9730	15	0	1	732	0	7
8	PFAM:PF01018	IPR006169	GTP1/OBG	2	157	212.8	0	2735021	941975	1906	0	0	0	732	0	8
9	SUPERFAMILY:SSF54862		-	2	62			2005633	941975	12	15	0	1	732	0	9
10	PFAM:PF06245	IPR008323	Protein of unknown function (DUF1015)	3	343	326.4	0	2702004	941975	3627	0	0	0	732	0	10
11	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	3	15			1023514	941975	24	135:all secretion /signal peptide, lipo	15	0	1	732	3	11
12	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	6	18			953065	941975	24	135:all secretion /signal peptide, lipo	15	0	1	732	3	12
13	DeepTMHMM:TMhelix		TMhelix	7	22			939560	941975	2056	141:DeepTMHMM: helix	15	0	1	732	6	13
14	PRINTS:PR00354	IPR000813	7Fe ferredoxin signature	8	19			2005629	941975	480	15	0	1	732	0	14
15	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	15	22			1023506	941975	26	135:all secretion /signal peptide, lipo	15	0	1	732	3	15
16	SMART:SM00935	IPR005632		15	173			953062	941975	1	15	0	1	732	0	16
17	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	17	176			2664258	941975	78	0	0	0	732	0	17
18	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	18	23			953068	941975	26	135:all secretion /signal peptide, lipo	15	0	1	732	3	18
19	PRINTS:PR00354	IPR000813	7Fe ferredoxin signature	18	29			2005630	941975	480	15	0	1	732	0	19
20	SIGNALP6:SP		SP	22	23	0		1012381	941975	1978	135:all secretion /signal peptide, lipo	15	0	1	732	0	20
21	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	22	418			1023509	941975	3	136:Membrane Protein	15	0	1	732	0	21
22	DeepTMHMM:outside		outside	23	181			939561	941975	10025	15	0	1	732	0	22
23	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	23	181			953067	941975	3	136:Membrane Protein	15	0	1	732	0	23
24	SUPERFAMILY:SSF111384	IPR024930	Skp domain superfamily	29	173			953069	941975	10675	15	0	1	732	0	24
25	PFAM:PF03938	IPR005632	Outer membrane protein (OmpH-like)	29	171	68.3	8.1E-19	953063	941975	10017	136:Membrane Protein	15	0	1	732	0	25
26	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	30	60			2005632	941975	180	15	0	1	732	0	26
27	PFAM:PF00037	IPR017896	4Fe-4S binding domain	33	56	34.1	1.5E-8	2005631	941975	481	15	0	1	732	0	27
28	PRINTS:PR00354	IPR000813	7Fe ferredoxin signature	34	52			2005628	941975	480	15	0	1	732	0	28
29	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	44	331			1397954	941975	78	15	0	1	732	0	29
30	PFAM:PF01715		IPP transferase	50	291	266	0	2664257	941975	1448	0	0	0	732	0	30
31	SMART:SM00729	IPR006638		67	296			1419060	941975	1	15	0	1	732	0	31
32	SUPERFAMILY:SSF102114		-	67	263			1419063	941975	12	15	0	1	732	0	32
33	PFAM:PF04055	IPR007197	Radical SAM superfamily	71	250	54.6	1.6E-14	1419061	941975	48	15	0	1	732	0	33
34	CDD:cd01335		Radical_SAM	71	248			1419062	941975	258	15	0	1	732	0	34
35	PROSITE_PROFILES:PS51710	IPR031167	OBG-type guanine nucleotide-binding (G) domain profile.	158	327			2735024	941975	1908	0	0	0	732	0	35
36	CDD:cd01898	IPR031167	Obg	158	326			2735027	941975	1910	0	0	0	732	0	36
37	PFAM:PF01926	IPR006073	50S ribosome-binding GTPase	159	283	84	7.5E-24	2735023	941975	496	0	0	0	732	0	37
38	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	159	330			2735028	941975	78	0	0	0	732	0	38
39	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	160	181			2735020	941975	495	0	0	0	732	0	39
40	PFAM:PF17757	IPR041471	UvrB interaction domain	165	252	85.4	2.2E-24	1397937	941975	1712	15	0	1	732	0	40
41	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	181	200			2735019	941975	495	0	0	0	732	0	41
42	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	209	225			2735017	941975	495	0	0	0	732	0	42
43	PRINTS:PR00326	IPR006073	GTP1/OBG GTP-binding protein family signature	226	245			2735018	941975	495	0	0	0	732	0	43
44	PROSITE_PROFILES:PS51881	IPR015349	Obg C-terminal (OCT) domain profile.	343	421			2735025	941975	1909	0	0	0	732	0	44
45	SUPERFAMILY:SSF102741	IPR036346	GTP-binding protein OBG, C-terminal domain superfamily	350	421			2735029	941975	1912	0	0	0	732	0	45
46	PFAM:PF09269	IPR015349	Domain of unknown function (DUF1967)	351	419	86.9	6.3E-25	2735022	941975	1905	0	0	0	732	0	46
47	SUPERFAMILY:SSF141259	IPR036101	CarD-like/TRCF, RNAP-interacting domain superfamily	482	560			1397967	941975	2278	15	0	1	732	0	47
48	SMART:SM01058	IPR003711		490	588			1397934	941975	1	15	0	1	732	0	48
49	PFAM:PF02559	IPR003711	CarD-like/TRCF domain	491	587	82.6	2.4E-23	1397941	941975	2277	15	0	1	732	0	49
50	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	553	796			1397956	941975	78	15	0	1	732	0	50
51	CDD:cd17991		DEXHc_TRCF	600	793			1397952	941975	2427	15	0	1	732	0	51
52	SMART:SM00487	IPR014001		611	802			1397932	941975	1	15	0	1	732	0	52
53	PFAM:PF00270	IPR011545	DEAD/DEAH box helicase	617	776	58	1.0E-15	1397939	941975	2167	15	0	1	732	0	53
54	PROSITE_PROFILES:PS51192	IPR014001	Superfamilies 1 and 2 helicase ATP-binding type-1 domain profile.	629	791			1397950	941975	487	15	0	1	732	0	54
55	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	793	1002			1397965	941975	78	15	0	1	732	0	55
56	PROSITE_PROFILES:PS51194	IPR001650	Superfamilies 1 and 2 helicase C-terminal domain profile.	799	966			1397948	941975	1121	15	0	1	732	0	56
57	PFAM:PF00271	IPR001650	Helicase conserved C-terminal domain	819	921	54.3	1.5E-14	1397945	941975	1120	15	0	1	732	0	57
58	SMART:SM00490	IPR001650		837	922			1397930	941975	1	15	0	1	732	0	58
59	SUPERFAMILY:SSF143517	IPR037235	TRCF-like, C-terminal D7 domain	1015	1170			1397966	941975	2429	15	0	1	732	0	59
60	SMART:SM00982	IPR005118		1027	1128			1397935	941975	1	15	0	1	732	0	60
61	PFAM:PF03461	IPR005118	TRCF domain	1029	1120	77.6	6.9E-22	1397943	941975	2426	15	0	1	732	0	61

↑ Top