Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_00961
Genome uid: 222
986636-987049 [+] (137)

Sequence:

DLEECLNFSLTKAQQHVYQAFKAELSEYNVTPVQYALLRCLWDKDGQTSKNLANRLSLDYSTMTTHLDRMESKGLILKTT
DPNDRRALQILLTDKGRSLEKPVTEAIIRANDKFLAKIDNDKWETFRSFLLELSEA

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	50			2695608	942177	3	136:Membrane Protein	0	0	0	934	0	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	22			1354616	942177	19	135:all secretion /signal peptide, lipo	15	0	1	934	3	2
3	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	5			1354625	942177	21	135:all secretion /signal peptide, lipo	15	0	1	934	3	3
4	DeepTMHMM:signal		signal	1	22			1359958	942177	2198	15	0	1	934	0	4
5	DeepTMHMM:inside		inside	1	49			2716076	942177	9730	0	0	0	934	0	5
6	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	1	136			2736620	942177	42	0	0	0	934	0	6
7	PROSITE_PROFILES:PS50995	IPR000835	MarR-type HTH domain profile.	3	136			2736619	942177	630	0	0	0	934	0	7
8	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	5	17			1354618	942177	24	135:all secretion /signal peptide, lipo	15	0	1	934	3	8
9	PFAM:PF11349	IPR014487	Protein of unknown function (DUF3151)	10	133	73.7	1.3E-20	2025477	942177	11576	15	0	1	934	0	9
10	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	17	22			1354621	942177	26	135:all secretion /signal peptide, lipo	15	0	1	934	3	10
11	SMART:SM00487	IPR014001		20	199			555404	942177	1	15	0	1	934	0	11
12	SIGNALP6:SP		SP	22	23	0		1370808	942177	1978	135:all secretion /signal peptide, lipo	15	0	1	934	0	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	22	786			1354617	942177	3	136:Membrane Protein	15	0	1	934	0	13
14	DeepTMHMM:outside		outside	23	786			1359960	942177	10025	15	0	1	934	0	14
15	SMART:SM00347	IPR000835		23	124			2736617	942177	1	0	0	0	934	0	15
16	PFAM:PF04851	IPR006935	Type III restriction enzyme, res subunit	23	174	76.5	2.3E-21	555406	942177	1119	15	0	1	934	0	16
17	PFAM:PF01047	IPR000835	MarR family	31	88	63.5	1.2E-17	2736618	942177	629	0	0	0	934	0	17
18	PFAM:PF07494	IPR011110	Two component regulator propeller	36	60	19.8	0.00058	1354561	942177	6030	15	0	1	934	0	18
19	SUPERFAMILY:SSF63829		-	38	199			1354647	942177	12	15	0	1	934	0	19
20	PROSITE_PROFILES:PS51192	IPR014001	Superfamilies 1 and 2 helicase ATP-binding type-1 domain profile.	39	192			555408	942177	487	15	0	1	934	0	20
21	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	46	353			555410	942177	78	15	0	1	934	0	21
22	PRINTS:PR00598	IPR000835	Bacterial regulatory protein MarR family signature	47	64			2736614	942177	623	0	0	0	934	0	22
23	DeepTMHMM:TMhelix		TMhelix	50	60			2716077	942177	2056	141:DeepTMHMM: helix	0	0	0	934	6	23
24	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	50	73			2695606	942177	5	136:Membrane Protein	0	0	0	934	0	24
25	DeepTMHMM:outside		outside	61	166			2716078	942177	10025	0	0	0	934	0	25
26	PRINTS:PR00598	IPR000835	Bacterial regulatory protein MarR family signature	64	80			2736616	942177	623	0	0	0	934	0	26
27	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	73	166			2695607	942177	18	136:Membrane Protein	0	0	0	934	0	27
28	PFAM:PF07494	IPR011110	Two component regulator propeller	81	104	20	0.00049	1354560	942177	6030	15	0	1	934	0	28
29	PRINTS:PR00598	IPR000835	Bacterial regulatory protein MarR family signature	83	100			2736615	942177	623	0	0	0	934	0	29
30	PRINTS:PR00598	IPR000835	Bacterial regulatory protein MarR family signature	113	134			2736613	942177	623	0	0	0	934	0	30
31	PROSITE_PROFILES:PS51194	IPR001650	Superfamilies 1 and 2 helicase C-terminal domain profile.	240	406			555409	942177	1121	15	0	1	934	0	31
32	PFAM:PF00271	IPR001650	Helicase conserved C-terminal domain	244	350	50.9	1.7E-13	555407	942177	1120	15	0	1	934	0	32
33	SMART:SM00490	IPR001650		269	351			555405	942177	1	15	0	1	934	0	33
34	PFAM:PF07494	IPR011110	Two component regulator propeller	307	330	20.4	0.00036	1354562	942177	6030	15	0	1	934	0	34
35	SUPERFAMILY:SSF63829		-	310	513			1354649	942177	12	15	0	1	934	0	35
36	SUPERFAMILY:SSF63829		-	459	658			1354648	942177	12	15	0	1	934	0	36
37	PFAM:PF07494	IPR011110	Two component regulator propeller	540	562	17.4	0.0034	1354563	942177	6030	15	0	1	934	0	37
38	PFAM:PF07495	IPR011123	Y_Y_Y domain	716	780	58.9	3.4E-16	1354559	942177	5367	15	0	1	934	0	38
39	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	786	805			1354619	942177	5	136:Membrane Protein	15	0	1	934	0	39
40	DeepTMHMM:TMhelix		TMhelix	787	807			1359961	942177	2056	141:DeepTMHMM: helix	15	0	1	934	6	40
41	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	805	1357			1354623	942177	18	136:Membrane Protein	15	0	1	934	0	41
42	DeepTMHMM:inside		inside	808	1357			1359962	942177	9730	15	0	1	934	0	42
43	SUPERFAMILY:SSF47384	IPR036097	Signal transduction histidine kinase, dimerisation/phosphoacceptor domain superfamily	824	900			1354646	942177	108	15	0	1	934	0	43
44	CDD:cd00082	IPR003661	HisKA	832	896			1354644	942177	356	15	0	1	934	0	44
45	SMART:SM00388	IPR003661		833	900			1354552	942177	1	15	0	1	934	0	45
46	PFAM:PF00512	IPR003661	His Kinase A (phospho-acceptor) domain	834	898	39.5	4.3E-10	1354564	942177	355	15	0	1	934	0	46
47	PROSITE_PROFILES:PS50109	IPR005467	Histidine kinase domain profile.	840	1061			1354641	942177	103	15	0	1	934	0	47
48	SUPERFAMILY:SSF55874	IPR036890	Histidine kinase/HSP90-like ATPase superfamily	888	1059			1354654	942177	122	15	0	1	934	0	48
49	SMART:SM00387	IPR003594		945	1061			1354553	942177	1	15	0	1	934	0	49
50	PFAM:PF02518	IPR003594	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	946	1060	86.4	1.8E-24	1354558	942177	99	15	0	1	934	0	50
51	CDD:cd00075		HATPase	950	1057			1354645	942177	456	15	0	1	934	0	51
52	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	982	997			1354550	942177	95	15	0	1	934	0	52
53	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	1020	1039			1354549	942177	95	15	0	1	934	0	53
54	PRINTS:PR00344	IPR004358	Bacterial sensor protein C-terminal signature	1044	1058			1354551	942177	95	15	0	1	934	0	54
55	SMART:SM00448	IPR001789		1107	1220			1354555	942177	1	15	0	1	934	0	55
56	SUPERFAMILY:SSF52172	IPR011006	CheY-like superfamily	1107	1233			1354652	942177	129	15	0	1	934	0	56
57	PROSITE_PROFILES:PS50110	IPR001789	Response regulatory domain profile.	1108	1224			1354640	942177	125	15	0	1	934	0	57
58	PFAM:PF00072	IPR001789	Response regulator receiver domain	1109	1220	81.6	4.5E-23	1354556	942177	123	15	0	1	934	0	58
59	CDD:cd17574		REC_OmpR	1110	1210			1354643	942177	127	15	0	1	934	0	59
60	PROSITE_PROFILES:PS01124	IPR018060	Bacterial regulatory proteins, araC family DNA-binding domain profile.	1255	1355			1354627	942177	1337	15	0	1	934	0	60
61	SMART:SM00342	IPR018060		1269	1353			1354554	942177	1	15	0	1	934	0	61
62	PFAM:PF12833	IPR018060	Helix-turn-helix domain	1276	1354	63	2.4E-17	1354557	942177	1014	15	0	1	934	0	62
63	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	1305	1355			1354651	942177	657	15	0	1	934	0	63

↑ Top