Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01007
Genome uid: 222
1046020-1046748 [+] (242)

Sequence:

YNLAKVYRKPPWGLFDIIIVYLGIILAGIIFGMHGDGLLIWLTRFGIKDTPLMYFILGFMVQFTATILLVIIMAGIRGAS
LKDLGINIPGGRLFVTYGLIGGMGLLLIILILSYPVNLLQPDIQPQVFEQMLRSTISGPSFLVLFIMGAVLAPLSEELFY
RGMIYPVLRYPLGPIWGALVAGLIFGAAHWDVWRAIPLAVGGVVLCYLYEKSGSIFVTALAHGIWNGIMAGAVYISMTHV
V

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			2728250	942223	18	136:Membrane Protein	0	0	0	980	0	1
2	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	64			2015690	942223	3	136:Membrane Protein	13	0	1	980	0	2
3	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	41			724897	942223	18	136:Membrane Protein	13	0	1	980	0	3
4	DeepTMHMM:inside		inside	1	49			698235	942223	9730	13	0	1	980	0	4
5	SMART:SM00448	IPR001789		2	115			2693363	942223	1	0	0	0	980	0	5
6	CDD:cd17542		REC_CheY	2	119			2693366	942223	2580	0	0	0	980	0	6
7	SUPERFAMILY:SSF52172	IPR011006	CheY-like superfamily	2	119			2693367	942223	129	0	0	0	980	0	7
8	PROSITE_PROFILES:PS50110	IPR001789	Response regulatory domain profile.	3	119			2693365	942223	125	0	0	0	980	0	8
9	PFAM:PF06857	IPR023439	Malonate decarboxylase delta subunit (MdcD)	4	86	107.4	3.3E-31	1946056	942223	6990	13	0	1	980	0	9
10	PFAM:PF00072	IPR001789	Response regulator receiver domain	4	115	113.2	6.9E-33	2693364	942223	123	0	0	0	980	0	10
11	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	33			2728247	942223	5	136:Membrane Protein	0	0	0	980	0	11
12	SUPERFAMILY:SSF53271	IPR029057	Phosphoribosyltransferase-like	15	165			2015693	942223	305	13	0	1	980	0	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	33	52			2728255	942223	3	136:Membrane Protein	0	0	0	980	0	13
14	PFAM:PF07963	IPR012902	Prokaryotic N-terminal methylation motif	35	62	36.1	2.8E-9	724893	942223	2950	13	0	1	980	0	14
15	SUPERFAMILY:SSF54523	IPR045584	Pilin-like	41	106			724900	942223	2951	13	0	1	980	0	15
16	PFAM:PF00156	IPR000836	Phosphoribosyl transferase domain	41	153	43.8	1.6E-11	2015688	942223	301	13	0	1	980	0	16
17	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	41	65			724895	942223	5	136:Membrane Protein	13	0	1	980	0	17
18	CDD:cd06223	IPR000836	PRTases_typeI	41	175			2015692	942223	304	13	0	1	980	0	18
19	DeepTMHMM:TMhelix		TMhelix	50	59			698236	942223	2056	141:DeepTMHMM: helix	13	0	1	980	6	19
20	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	52	75			2728243	942223	5	136:Membrane Protein	0	0	0	980	0	20
21	DeepTMHMM:outside		outside	60	328			698237	942223	10025	13	0	1	980	0	21
22	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	64	83			2015689	942223	5	136:Membrane Protein	13	0	1	980	0	22
23	PFAM:PF07596	IPR011453	Protein of unknown function (DUF1559)	65	310	193.4	0	724891	942223	11535	13	0	1	980	0	23
24	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	65	328			724899	942223	3	136:Membrane Protein	13	0	1	980	0	24
25	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	75	94			2728252	942223	18	136:Membrane Protein	0	0	0	980	0	25
26	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	83	177			2015691	942223	18	136:Membrane Protein	13	0	1	980	0	26
27	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	94	117			2728244	942223	5	136:Membrane Protein	0	0	0	980	0	27
28	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	117	136			2728256	942223	3	136:Membrane Protein	0	0	0	980	0	28
29	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	136	156			2728242	942223	5	136:Membrane Protein	0	0	0	980	0	29
30	PFAM:PF02517	IPR003675	Type II CAAX prenyl endopeptidase Rce1-like	140	228	68.7	4.2E-19	2728241	942223	909	0	0	0	980	0	30
31	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	156	167			2728251	942223	18	136:Membrane Protein	0	0	0	980	0	31
32	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	167	187			2728248	942223	5	136:Membrane Protein	0	0	0	980	0	32
33	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	187	192			2728254	942223	3	136:Membrane Protein	0	0	0	980	0	33
34	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	192	210			2728246	942223	5	136:Membrane Protein	0	0	0	980	0	34
35	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	210	216			2728249	942223	18	136:Membrane Protein	0	0	0	980	0	35
36	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	216	238			2728245	942223	5	136:Membrane Protein	0	0	0	980	0	36
37	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	238	242			2728253	942223	3	136:Membrane Protein	0	0	0	980	0	37

↑ Top