Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01596
Genome uid: 222
1629759-1630646 [+] (295)

Sequence:

VQKNEDLYVLIITGLSGAGKSQAVNCLEDIGYYCVDNMPPALLNKFVELSIQSEGKVDKVALVADVRGGEFFNDLSQALA
ELKESCIPFEILFLEASNEVLVRRFKESRRRHPLSENRNLLNAIKLERDMLEELRGQAGVVVDTSNLSPRELKDKLQQHF
KQHEKDGFIVHLLSFGYKSGIPLDSDIVIDVRFLTNPFYDPVMRNMTGEDQPVINYVLDSPVTKSFTRRFLNLLKFLIPH
YVKEGKTSLTVSIGCTGGQHRSVALTDYIGRQLRKMGYNVMVRHRDIAKYKVEE

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			2660554	942792	18	136:Membrane Protein	0	0	0	1549	0	1
2	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	146			1076520	942792	18	136:Membrane Protein	13	0	1	1549	0	2
3	SUPERFAMILY:SSF88946	IPR013325	RNA polymerase sigma factor, region 2	3	105			2698439	942792	458	0	0	0	1549	0	3
4	SUPERFAMILY:SSF53383	IPR015424	Pyridoxal phosphate-dependent transferase	4	421			1989197	942792	245	13	0	1	1549	0	4
5	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	8	164			2729614	942792	78	0	0	0	1549	0	5
6	PFAM:PF03668	IPR005337	P-loop ATPase protein family	9	290	333.7	0	2729613	942792	2563	0	0	0	1549	0	6
7	PFAM:PF00464	IPR039429	Serine hydroxymethyltransferase	9	392	496.5	0	1989193	942792	1184	13	0	1	1549	0	7
8	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	34			2660556	942792	5	136:Membrane Protein	0	0	0	1549	0	8
9	CDD:cd00378	IPR001085	SHMT	11	412			1989195	942792	1185	13	0	1	1549	0	9
10	PFAM:PF04542	IPR007627	Sigma-70 region 2	22	94	41.3	9.7E-11	2698437	942792	593	0	0	0	1549	0	10
11	PFAM:PF11823	IPR021778	Putative Se/S carrier protein-like	27	95	51.8	4.2E-14	2281223	942792	3668	13	0	0	1549	0	11
12	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	34	113			569265	942792	42	13	0	1	1549	0	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	34	201			2660555	942792	3	136:Membrane Protein	0	0	0	1549	0	13
14	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	37	106			569258	942792	323	13	0	1	1549	0	14
15	CDD:cd07377	IPR000524	WHTH_GntR	38	104			569260	942792	324	13	0	1	1549	0	15
16	SMART:SM00345	IPR000524		43	103			569254	942792	1	13	0	1	1549	0	16
17	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	48	103	31.5	9.9E-8	569256	942792	322	13	0	1	1549	0	17
18	SUPERFAMILY:SSF88659	IPR013324	RNA polymerase sigma factor, region 3/4-like	112	181			2698438	942792	595	0	0	0	1549	0	18
19	PFAM:PF08281	IPR013249	Sigma-70, region 4	123	175	30.2	2.5E-7	2698436	942792	592	0	0	0	1549	0	19
20	SUPERFAMILY:SSF102114		-	128	417			2281228	942792	12	13	0	0	1549	0	20
21	SUPERFAMILY:SSF47781	IPR010994	RuvA domain 2-like	134	197			2660557	942792	1818	0	0	0	1549	0	21
22	PFAM:PF12836		Helix-hairpin-helix motif	135	196	60.7	1.1E-16	2660553	942792	1752	0	0	0	1549	0	22
23	SUPERFAMILY:SSF53383	IPR015424	Pyridoxal phosphate-dependent transferase	139	507			569263	942792	245	13	0	1	1549	0	23
24	SMART:SM00278	IPR003583		145	165			2660552	942792	1	0	0	0	1549	0	24
25	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	146	171			1076517	942792	5	136:Membrane Protein	13	0	1	1549	0	25
26	CDD:cd00609		AAT_like	148	475			569261	942792	680	13	0	1	1549	0	26
27	PROSITE_PROFILES:PS51918	IPR007197	Radical SAM core domain profile.	163	383			2281226	942792	190	13	0	0	1549	0	27
28	SMART:SM00729	IPR006638		167	376			2281221	942792	1	13	0	0	1549	0	28
29	CDD:cd01335		Radical_SAM	171	370			2281227	942792	258	13	0	0	1549	0	29
30	PFAM:PF04055	IPR007197	Radical SAM superfamily	171	327	63.3	3.4E-17	2281225	942792	48	13	0	0	1549	0	30
31	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	171	176			1076521	942792	3	136:Membrane Protein	13	0	1	1549	0	31
32	SMART:SM00278	IPR003583		175	195			2660551	942792	1	0	0	0	1549	0	32
33	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	176	196			1076518	942792	5	136:Membrane Protein	13	0	1	1549	0	33
34	PFAM:PF00155	IPR004839	Aminotransferase class I and II	181	471	70.9	1.1E-19	569255	942792	679	13	0	1	1549	0	34
35	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	196	619			1076519	942792	18	136:Membrane Protein	13	0	1	1549	0	35
36	SMART:SM00876	IPR010722		340	434			2281222	942792	1	13	0	0	1549	0	36
37	PFAM:PF06968	IPR010722	Biotin and Thiamin Synthesis associated domain	344	433	23.6	4.0E-5	2281224	942792	1033	13	0	0	1549	0	37

↑ Top