Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01947
Genome uid: 222
2004144-2004641 [+] (165)

Sequence:

KENKILNLAYGSNLNLGQMVYRCPTAKIYGKGILLDYQLLFKGREDNAYATIEPKRGSKVPVLVWELQPEDEKALDYYEG
YPRFYEKMEVELNLETGERITAMVYIMTDEVMERIQLNLPSRSYLETVRVGYAMAGFDNKYIEAALDISRKEQDLRNRER
RQVR

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	44			2111386	943139	21	135:all secretion /signal peptide, lipo	13	0	1	1896	3	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	61			2111384	943139	19	135:all secretion /signal peptide, lipo	13	0	1	1896	3	2
3	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			720926	943139	18	136:Membrane Protein	13	0	1	1896	0	3
4	DeepTMHMM:inside		inside	1	19			707576	943139	9730	13	0	1	1896	0	4
5	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	1	82			2707816	943139	42	0	0	0	1896	0	5
6	SUPERFAMILY:SSF57802		-	4	56			2667071	943139	12	0	0	0	1896	0	6
7	PROSITE_PROFILES:PS50903	IPR024934	Rubredoxin-like domain profile.	4	56			2667069	943139	1827	0	0	0	1896	0	7
8	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	6	75			2707814	943139	323	0	0	0	1896	0	8
9	PFAM:PF00301	IPR024935	Rubredoxin	6	53	82	2.1E-23	2667068	943139	1826	0	0	0	1896	0	9
10	PRINTS:PR00163	IPR024935	Rubredoxin signature	6	23			2667066	943139	1825	0	0	0	1896	0	10
11	PFAM:PF07963	IPR012902	Prokaryotic N-terminal methylation motif	7	33	33.6	1.8E-8	720924	943139	2950	13	0	1	1896	0	11
12	CDD:cd07377	IPR000524	WHTH_GntR	7	72			2707815	943139	324	0	0	0	1896	0	12
13	CDD:cd00730	IPR024935	rubredoxin	7	55			2667070	943139	1826	0	0	0	1896	0	13
14	SUPERFAMILY:SSF110857	IPR036568	Gamma-glutamyl cyclotransferase-like superfamily	9	121			2735840	943139	1997	0	0	0	1896	0	14
15	CDD:cd06661	IPR013024	GGCT_like	9	108			2735839	943139	1996	0	0	0	1896	0	15
16	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	9	72	41.6	6.9E-11	2707813	943139	322	0	0	0	1896	0	16
17	PFAM:PF06094	IPR009288	Gamma-glutamyl cyclotransferase, AIG2-like	10	111	43.5	4.1E-11	2735838	943139	1995	0	0	0	1896	0	17
18	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	36			720927	943139	5	136:Membrane Protein	13	0	1	1896	0	18
19	SIGNALP6:PILIN		PILIN	12	13	0		691741	943139	2004	135:all secretion /signal peptide, lipo	13	0	1	1896	0	19
20	SUPERFAMILY:SSF54523	IPR045584	Pilin-like	12	133			720929	943139	2951	13	0	1	1896	0	20
21	SMART:SM00345	IPR000524		12	72			2707812	943139	1	0	0	0	1896	0	21
22	DeepTMHMM:TMhelix		TMhelix	20	33			707577	943139	2056	141:DeepTMHMM: helix	13	0	1	1896	6	22
23	DeepTMHMM:outside		outside	34	322			707578	943139	10025	13	0	1	1896	0	23
24	PFAM:PF07596	IPR011453	Protein of unknown function (DUF1559)	36	301	158	0	720925	943139	11535	13	0	1	1896	0	24
25	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	36	322			720928	943139	3	136:Membrane Protein	13	0	1	1896	0	25
26	PRINTS:PR00163	IPR024935	Rubredoxin signature	36	53			2667067	943139	1825	0	0	0	1896	0	26
27	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	44	57			2111382	943139	24	135:all secretion /signal peptide, lipo	13	0	1	1896	3	27
28	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	57	61			2111380	943139	26	135:all secretion /signal peptide, lipo	13	0	1	1896	3	28
29	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	61	158			2111389	943139	3	136:Membrane Protein	13	0	1	1896	0	29
30	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	321	558			1978432	943139	78	13	0	1	1896	0	30
31	PROSITE_PROFILES:PS50893	IPR003439	ATP-binding cassette, ABC transporter-type domain profile.	338	569			1978430	943139	76	13	0	1	1896	0	31
32	CDD:cd03230		ABC_DR_subfamily_A	338	547			1978431	943139	926	13	0	1	1896	0	32
33	PFAM:PF00005	IPR003439	ABC transporter	354	497	85.5	4.7E-24	1978429	943139	75	13	0	1	1896	0	33
34	SMART:SM00382	IPR003593		362	554			1978428	943139	1	13	0	1	1896	0	34

↑ Top