Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01960
Genome uid: 222
2014204-2014635 [+] (143)

Sequence:

GRLSYKMPEHFLLKVSALADKTDVIIPKVLEEGGQVVADKVKANLQAVVGSNLKSKPRSTGELIKALGVSPAGLDRNGNY
NVKVGFDEPRDDGESNAKIANILEYGKSGQPAKPFLKPAKTASKKACIEAMKRKLDEEINKS

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PFAM:PF14842	IPR028263	FliG N-terminal domain	3	99	83.2	1.6E-23	2666432	943152	566	0	0	0	1909	0	1
2	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	3	20			2666424	943152	565	0	0	0	1909	0	2
3	SUPERFAMILY:SSF48029	IPR011002	Flagellar motor switch protein FliG, alpha-helical	5	117			2666434	943152	569	0	0	0	1909	0	3
4	SUPERFAMILY:SSF54211	IPR020568	Ribosomal protein S5 domain 2-type fold	6	128			1450889	943152	156	13	0	1	1909	0	4
5	PFAM:PF03331	IPR004463	UDP-3-O-acyl N-acetylglycosamine deacetylase	7	302	288.8	0	1450880	943152	10879	13	0	1	1909	0	5
6	PFAM:PF04883	IPR010064	Bacteriophage HK97-gp10, putative tail-component	11	107	34.4	3.3E-8	2727587	943152	2889	0	0	0	1909	0	6
7	PFAM:PF03776	IPR005527	Septum formation topological specificity factor MinE	15	82	81.3	3.7E-23	2708292	943152	1043	0	0	0	1909	0	7
8	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	19	91			507082	943152	42	13	0	1	1909	0	8
9	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	22	90			507079	943152	323	13	0	1	1909	0	9
10	CDD:cd07377	IPR000524	WHTH_GntR	23	88			507080	943152	324	13	0	1	1909	0	10
11	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	25	86	43.6	1.7E-11	507078	943152	322	13	0	1	1909	0	11
12	SMART:SM00345	IPR000524		28	87			507076	943152	1	13	0	1	1909	0	12
13	SUPERFAMILY:SSF55229	IPR036707	Cell division topological specificity factor MinE superfamily	32	85			2708293	943152	1044	0	0	0	1909	0	13
14	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	32	59			2666430	943152	565	0	0	0	1909	0	14
15	SUPERFAMILY:SSF48008	IPR008920	Transcription regulator FadR/GntR, C-terminal	94	236			507081	943152	325	13	0	1	1909	0	15
16	SMART:SM00895	IPR011711		96	233			507075	943152	1	13	0	1	1909	0	16
17	PFAM:PF07729	IPR011711	FCD domain	96	232	59.7	3.7E-16	507077	943152	316	13	0	1	1909	0	17
18	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	114	138			2666426	943152	565	0	0	0	1909	0	18
19	SUPERFAMILY:SSF48029	IPR011002	Flagellar motor switch protein FliG, alpha-helical	114	325			2666435	943152	569	0	0	0	1909	0	19
20	PFAM:PF14841	IPR032779	FliG middle domain	115	186	87.8	4.0E-25	2666431	943152	568	0	0	0	1909	0	20
21	SUPERFAMILY:SSF54211	IPR020568	Ribosomal protein S5 domain 2-type fold	144	302			1450883	943152	156	13	0	1	1909	0	21
22	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	194	220			2666428	943152	565	0	0	0	1909	0	22
23	PFAM:PF01706	IPR023087	FliG C-terminal domain	217	324	122.1	1.1E-35	2666433	943152	567	0	0	0	1909	0	23
24	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	225	246			2666425	943152	565	0	0	0	1909	0	24
25	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	247	268			2666429	943152	565	0	0	0	1909	0	25
26	PRINTS:PR00954	IPR000090	Flagellar motor switch protein FliG signature	271	298			2666427	943152	565	0	0	0	1909	0	26
27	SUPERFAMILY:SSF54637	IPR029069	HotDog domain superfamily	321	462			1450890	943152	84	13	0	1	1909	0	27
28	CDD:cd01288		FabZ	332	462			1450882	943152	1872	13	0	1	1909	0	28
29	PFAM:PF07977	IPR013114	FabA-like domain	332	456	105	2.3E-30	1450881	943152	1871	13	0	1	1909	0	29

↑ Top