Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0159231: Syntrophomonas erecta sporosyntropha, JCM 13344 [-] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_02439
Genome uid: 222
2499774-2500520 [+] (248)

Sequence:

LRLENICMAVNGNNGESKEILRGVNIEFKSGKLYAITGPNGGGKSSIAKVVMGIYRHSSGHIYFKNKEISEMSVTERAAE
GISYAFQQPPRFKGLTVSDLLKTAQPGLDNMGLRKSLRDVGLCPEDYLDRDLGPGLSGGEMKRIEIAQVLVRNAAISIFD
EPEAGVDLWTIQRLIGIIISRFKGNPDATAVIITHNENVLPICDEIIVVEEGLIRDRGTPAEIWPLIREDIECKKRLECR
GEMGYEI

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	26			2694139	943624	19	135:all secretion /signal peptide, lipo	0	0	0	2381	3	1
2	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	10			2694138	943624	21	135:all secretion /signal peptide, lipo	0	0	0	2381	3	2
3	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	269			2666732	943624	18	136:Membrane Protein	0	0	0	2381	0	3
4	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	8			2182099	943624	21	135:all secretion /signal peptide, lipo	0	1	0	2381	3	4
5	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	28			2182097	943624	19	135:all secretion /signal peptide, lipo	0	0	0	2381	3	5
6	PFAM:PF01557	IPR011234	Fumarylacetoacetate (FAA) hydrolase family	1	181	154.3	4.2039E-45	563594	943624	4524	0	0	1	2381	0	6
7	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	1	225			2734725	943624	78	0	0	0	2381	0	7
8	PROSITE_PROFILES:PS50893	IPR003439	ATP-binding cassette, ABC transporter-type domain profile.	1	237			2734724	943624	76	0	0	0	2381	0	8
9	SUPERFAMILY:SSF56529	IPR036663	Fumarylacetoacetase-like, C-terminal domain superfamily	1	202			563596	943624	4525	0	0	1	2381	0	9
10	SUPERFAMILY:SSF51735	IPR036291	NAD(P)-binding domain superfamily	5	230			1993131	943624	206	0	0	1	2381	0	10
11	SUPERFAMILY:SSF56601	IPR012338	Beta-lactamase/transpeptidase-like	7	291			2182101	943624	558	0	0	0	2381	0	11
12	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	8	18			2182096	943624	24	135:all secretion /signal peptide, lipo	0	1	0	2381	3	12
13	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	10	22			2694142	943624	24	135:all secretion /signal peptide, lipo	0	0	0	2381	3	13
14	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	13	31			1993127	943624	2301	0	0	1	2381	0	14
15	PFAM:PF00106	IPR002347	short chain dehydrogenase	13	193	89.3	2.1E-25	1993129	943624	4192	0	0	1	2381	0	15
16	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	18	28			2182098	943624	26	135:all secretion /signal peptide, lipo	0	1	0	2381	3	16
17	PFAM:PF00005	IPR003439	ABC transporter	21	164	85.7	3.9E-24	2734723	943624	75	0	0	0	2381	0	17
18	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	22	26			2694140	943624	26	135:all secretion /signal peptide, lipo	0	0	0	2381	3	18
19	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	26	187			2694141	943624	3	136:Membrane Protein	0	0	0	2381	0	19
20	SUPERFAMILY:SSF51445	IPR017853	Glycoside hydrolase superfamily	26	538			2666734	943624	525	0	0	0	2381	0	20
21	SIGNALP6:SP		SP	28	29	0		2206430	943624	1978	135:all secretion /signal peptide, lipo	0	0	0	2381	0	21
22	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	28	402			2182100	943624	3	136:Membrane Protein	0	0	0	2381	0	22
23	SMART:SM00382	IPR003593		30	229			2734722	943624	1	0	0	0	2381	0	23
24	SIGNALP6:SP		SP	32	33	0		220635	943624	1978	135:all secretion /signal peptide, lipo	0	1	1	2381	0	24
25	CDD:cd16896		LT_Slt70-like	35	180			2694143	943624	2598	0	0	0	2381	0	25
26	SUPERFAMILY:SSF53955	IPR023346	Lysozyme-like domain superfamily	37	186			2694144	943624	920	0	0	0	2381	0	26
27	SMART:SM00642	IPR006047		42	529			2666729	943624	1	0	0	0	2381	0	27
28	PFAM:PF01464	IPR008258	Transglycosylase SLT domain	42	148	101.8	1.8E-29	2694137	943624	2597	0	0	0	2381	0	28
29	PFAM:PF00768	IPR001967	D-alanyl-D-alanine carboxypeptidase	52	270	216.6	0	2182095	943624	555	0	0	0	2381	0	29
30	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	83	95			2182090	943624	554	0	0	0	2381	0	30
31	PRINTS:PR00081	IPR002347	Glucose/ribitol dehydrogenase family signature	88	100			1993125	943624	2301	0	0	1	2381	0	31
32	PFAM:PF00128	IPR006047	Alpha amylase, catalytic domain	96	455	140.8	7.39998E-41	2666730	943624	1646	0	0	0	2381	0	32
33	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	131	149			2182092	943624	554	0	0	0	2381	0	33
34	PRINTS:PR00725	IPR018044	D-Ala-D-Ala carboxypeptidase 1 (S11) family signature	158	172			2182091	943624	554	0	0	0	2381	0	34
35	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	269	288			2666733	943624	5	136:Membrane Protein	0	0	0	2381	0	35
36	SUPERFAMILY:SSF69189	IPR015956	Penicillin-binding protein, C-terminal domain superfamily	282	379			2182102	943624	557	0	0	0	2381	0	36
37	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	288	662			2666731	943624	3	136:Membrane Protein	0	0	0	2381	0	37
38	PFAM:PF07943	IPR012907	Penicillin-binding protein 5, C-terminal domain	290	380	59.5	2.7E-16	2182094	943624	556	0	0	0	2381	0	38
39	SMART:SM00936	IPR012907		290	381			2182093	943624	1	0	0	0	2381	0	39

↑ Top