Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_958367705.1: Anaerobutyricum hallii, na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01338
Genome uid: 228
50053-50730 [+] (225)

Sequence:

RLLIVEDEKELCDTISKSLYESGYEVDTCYDGHEALDYILTEDYDLIVLDLNLPGMDGMDILRELRKENEETKVLILSAR
SQIIDKVEGLDAGANDYMEKPFHIQELEARIRSLTRRKFVQKDICLHCKDIKFDTKKREAYAKGILVPLTRKENGILEYL
LLNQGRPVSQEELIEHVWDASIDSFSGSIRVHMSSLRKKFKAVLGYDPIVNKIGEGYKLVEGVS

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			462846	961820	3	136:Membrane Protein	0	0	1	1741	0	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	17			1550475	961820	19	135:all secretion /signal peptide, lipo	0	0	1	1741	3	2
3	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	3			1550476	961820	21	135:all secretion /signal peptide, lipo	0	0	1	1741	3	3
4	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	20			2183422	961820	18	136:Membrane Protein	0	0	0	1741	0	4
5	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	11			2698811	961820	18	136:Membrane Protein	0	0	0	1741	0	5
6	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	5			2728215	961820	3	136:Membrane Protein	0	0	0	1741	0	6
7	SMART:SM00448	IPR001789		0	112			2909118	961820	1	0	0	0	1741	0	7
8	SUPERFAMILY:SSF52172	IPR011006	CheY-like superfamily	0	178			2909125	961820	129	0	0	0	1741	0	8
9	DeepTMHMM:signal		signal	1	10			538786	961820	2198	0	0	1	1741	0	9
10	SUPERFAMILY:SSF101473	IPR036117	DhaL domain superfamily	1	205			2216391	961820	4856	0	0	0	1741	0	10
11	DeepTMHMM:inside		inside	1	15			2711929	961820	9730	0	0	0	1741	0	11
12	PROSITE_PROFILES:PS50110	IPR001789	Response regulatory domain profile.	1	116			2909122	961820	125	0	0	0	1741	0	12
13	CDD:cd16352	IPR005659	CheD	2	151			2664260	961820	1474	0	0	0	1741	0	13
14	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	3	12			1550479	961820	24	135:all secretion /signal peptide, lipo	0	0	1	1741	3	14
15	SUPERFAMILY:SSF64438	IPR011324	Cytotoxic necrotizing factor-like, catalytic	3	155			2664261	961820	1475	0	0	0	1741	0	15
16	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	3	75			2765021	961820	42	0	0	0	1741	0	16
17	PFAM:PF00072	IPR001789	Response regulator receiver domain	3	113	107.3	4.5E-31	2909119	961820	123	0	0	0	1741	0	17
18	CDD:cd17625		REC_OmpR_DrrD-like	3	118			2909124	961820	4194	0	0	0	1741	0	18
19	PROSITE_PROFILES:PS51480	IPR004007	DhaL domain profile.	4	205			2216390	961820	4855	0	0	0	1741	0	19
20	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	25			462849	961820	5	136:Membrane Protein	0	0	1	1741	0	20
21	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	5	33			2728226	961820	5	136:Membrane Protein	0	0	0	1741	0	21
22	PROSITE_PROFILES:PS50949	IPR000524	GntR-type HTH domain profile.	6	75			2765018	961820	323	0	0	0	1741	0	22
23	CDD:cd07377	IPR000524	WHTH_GntR	7	73			2765019	961820	324	0	0	0	1741	0	23
24	PFAM:PF09991	IPR018710	Predicted membrane protein (DUF2232)	8	306	136	1.5E-39	2728209	961820	5692	136:Membrane Protein	0	0	0	1741	0	24
25	PFAM:PF00873	IPR001036	AcrB/AcrD/AcrF family	9	1000	613.8	0	2698799	961820	5271	0	0	0	1741	0	25
26	PFAM:PF00392	IPR000524	Bacterial regulatory proteins, gntR family	10	72	58.3	4.4E-16	2765017	961820	322	0	0	0	1741	0	26
27	DeepTMHMM:outside		outside	11	11			538787	961820	10025	0	0	1	1741	0	27
28	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	11	36			2698793	961820	2537	0	0	0	1741	0	28
29	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	11	34			2698820	961820	5	136:Membrane Protein	0	0	0	1741	0	29
30	DeepTMHMM:TMhelix		TMhelix	12	21			538788	961820	2056	141:DeepTMHMM: helix	0	0	1	1741	6	30
31	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	12	17			1550477	961820	26	135:all secretion /signal peptide, lipo	0	0	1	1741	3	31
32	SMART:SM00345	IPR000524		12	72			2765015	961820	1	0	0	0	1741	0	32
33	DeepTMHMM:TMhelix		TMhelix	16	28			2711930	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	33
34	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	17	325			1550478	961820	3	136:Membrane Protein	0	0	1	1741	0	34
35	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	20	47			2183423	961820	5	136:Membrane Protein	0	0	0	1741	0	35
36	DeepTMHMM:inside		inside	22	53			538789	961820	9730	0	0	1	1741	0	36
37	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	25	53			462847	961820	18	136:Membrane Protein	0	0	1	1741	0	37
38	DeepTMHMM:outside		outside	29	334			2711931	961820	10025	0	0	0	1741	0	38
39	SMART:SM01120	IPR004007		30	205			2216388	961820	1	0	0	0	1741	0	39
40	PFAM:PF02734	IPR004007	DAK2 domain	31	204	179.2	0	2216389	961820	4854	0	0	0	1741	0	40
41	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	31	46			2765014	961820	2145	0	0	0	1741	0	41
42	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	33	39			2728210	961820	18	136:Membrane Protein	0	0	0	1741	0	42
43	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	34	333			2698800	961820	3	136:Membrane Protein	0	0	0	1741	0	43
44	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	39	58			2698792	961820	2537	0	0	0	1741	0	44
45	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	39	62			2728220	961820	5	136:Membrane Protein	0	0	0	1741	0	45
46	SUPERFAMILY:SSF82693		-	41	130			2698828	961820	12	0	0	0	1741	0	46
47	PROSITE_PROFILES:PS51186	IPR000182	Gcn5-related N-acetyltransferase (GNAT) domain profile.	45	188			1550480	961820	321	0	0	1	1741	0	47
48	PRINTS:PR00035	IPR000524	GntR bacterial regulatory protein HTH signature	45	62			2765013	961820	2145	0	0	0	1741	0	48
49	SUPERFAMILY:SSF55729	IPR016181	Acyl-CoA N-acyltransferase	46	303			1550482	961820	327	0	0	1	1741	0	49
50	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	47	717			2183424	961820	3	136:Membrane Protein	0	0	0	1741	0	50
51	PFAM:PF03975	IPR005659	CheD chemotactic sensory transduction	47	152	105.4	1.6E-30	2664259	961820	1473	0	0	0	1741	0	51
52	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	62	67			2728217	961820	3	136:Membrane Protein	0	0	0	1741	0	52
53	PFAM:PF13205	IPR032812	Bacterial Ig-like domain	66	164	45.1	1.4E-11	2183421	961820	912	0	0	0	1741	0	53
54	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	67	87			2728224	961820	5	136:Membrane Protein	0	0	0	1741	0	54
55	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	87	98			2728213	961820	18	136:Membrane Protein	0	0	0	1741	0	55
56	CDD:cd04301		NAT_SF	90	148			1550481	961820	326	0	0	1	1741	0	56
57	SUPERFAMILY:SSF48008	IPR008920	Transcription regulator FadR/GntR, C-terminal	94	214			2765020	961820	325	0	0	0	1741	0	57
58	PFAM:PF07729	IPR011711	FCD domain	95	212	24.7	2.5E-5	2765016	961820	316	0	0	0	1741	0	58
59	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	98	117			2728225	961820	5	136:Membrane Protein	0	0	0	1741	0	59
60	PFAM:PF13673	IPR000182	Acetyltransferase (GNAT) domain	112	172	39.1	6.3E-10	1550474	961820	320	0	0	1	1741	0	60
61	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	117	176			2728214	961820	3	136:Membrane Protein	0	0	0	1741	0	61
62	PROSITE_PROFILES:PS51755	IPR001867	OmpR/PhoB-type DNA-binding domain profile.	123	222			2909121	961820	126	0	0	0	1741	0	62
63	CDD:cd00383	IPR001867	trans_reg_C	131	220			2909123	961820	128	0	0	0	1741	0	63
64	SUPERFAMILY:SSF82693		-	138	317			2698827	961820	12	0	0	0	1741	0	64
65	SMART:SM00862	IPR001867		144	220			2909117	961820	1	0	0	0	1741	0	65
66	PFAM:PF00486	IPR001867	Transcriptional regulatory protein, C terminal	147	220	61.2	7.8E-17	2909120	961820	124	0	0	0	1741	0	66
67	PROSITE_PROFILES:PS51272	IPR001119	S-layer homology (SLH) domain profile.	167	231			2183426	961820	317	225:S-layer Homology:PROSITE	0	0	0	1741	0	67
68	PFAM:PF00395	IPR001119	S-layer homology domain	170	214	54.8	7.0E-15	2183419	961820	315	4:S-layer Homology:PFAM	0	0	0	1741	0	68
69	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	176	197			2728221	961820	5	136:Membrane Protein	0	0	0	1741	0	69
70	SUPERFAMILY:SSF82714	IPR027463	Multidrug efflux transporter AcrB TolC docking domain, DN/DC subdomains	183	267			2698829	961820	5272	0	0	0	1741	0	70
71	PFAM:PF18014	IPR041496	Acetyltransferase (GNAT) domain	196	318	82.1	2.7E-23	1550473	961820	320	0	0	1	1741	0	71
72	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	197	217			2728211	961820	18	136:Membrane Protein	0	0	0	1741	0	72
73	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	217	234			2728222	961820	5	136:Membrane Protein	0	0	0	1741	0	73
74	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	234	239			2728218	961820	3	136:Membrane Protein	0	0	0	1741	0	74
75	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	239	266			2728223	961820	5	136:Membrane Protein	0	0	0	1741	0	75
76	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	266	277			2728212	961820	18	136:Membrane Protein	0	0	0	1741	0	76
77	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	277	304			2728219	961820	5	136:Membrane Protein	0	0	0	1741	0	77
78	PROSITE_PROFILES:PS51272	IPR001119	S-layer homology (SLH) domain profile.	294	357			2183425	961820	317	225:S-layer Homology:PROSITE	0	0	0	1741	0	78
79	PFAM:PF00395	IPR001119	S-layer homology domain	296	340	20.5	0.00035	2183420	961820	315	4:S-layer Homology:PFAM	0	0	0	1741	0	79
80	SUPERFAMILY:SSF82866		-	297	488			2698826	961820	12	0	0	0	1741	0	80
81	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	304	319			2728216	961820	3	136:Membrane Protein	0	0	0	1741	0	81
82	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	329	353			2698795	961820	2537	0	0	0	1741	0	82
83	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	333	352			2698819	961820	5	136:Membrane Protein	0	0	0	1741	0	83
84	DeepTMHMM:TMhelix		TMhelix	335	352			2711932	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	84
85	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	352	358			2698810	961820	18	136:Membrane Protein	0	0	0	1741	0	85
86	DeepTMHMM:inside		inside	353	358			2711933	961820	9730	0	0	0	1741	0	86
87	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	358	380			2698816	961820	5	136:Membrane Protein	0	0	0	1741	0	87
88	DeepTMHMM:TMhelix		TMhelix	359	379			2711934	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	88
89	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	380	385			2698805	961820	3	136:Membrane Protein	0	0	0	1741	0	89
90	DeepTMHMM:outside		outside	380	387			2711935	961820	10025	0	0	0	1741	0	90
91	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	383	408			2698796	961820	2537	0	0	0	1741	0	91
92	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	385	409			2698823	961820	5	136:Membrane Protein	0	0	0	1741	0	92
93	DeepTMHMM:TMhelix		TMhelix	388	406			2711936	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	93
94	DeepTMHMM:inside		inside	407	430			2711937	961820	9730	0	0	0	1741	0	94
95	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	409	429			2698808	961820	18	136:Membrane Protein	0	0	0	1741	0	95
96	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	429	450			2698821	961820	5	136:Membrane Protein	0	0	0	1741	0	96
97	DeepTMHMM:TMhelix		TMhelix	431	451			2711938	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	97
98	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	436	460			2698798	961820	2537	0	0	0	1741	0	98
99	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	450	461			2698802	961820	3	136:Membrane Protein	0	0	0	1741	0	99
100	DeepTMHMM:outside		outside	452	461			2711939	961820	10025	0	0	0	1741	0	100
101	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	461	485			2698794	961820	2537	0	0	0	1741	0	101
102	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	461	486			2698818	961820	5	136:Membrane Protein	0	0	0	1741	0	102
103	DeepTMHMM:TMhelix		TMhelix	462	480			2711940	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	103
104	DeepTMHMM:inside		inside	481	518			2711941	961820	9730	0	0	0	1741	0	104
105	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	486	518			2698812	961820	18	136:Membrane Protein	0	0	0	1741	0	105
106	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	518	541			2698817	961820	5	136:Membrane Protein	0	0	0	1741	0	106
107	DeepTMHMM:TMhelix		TMhelix	519	534			2711942	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	107
108	PRINTS:PR00702	IPR001036	Acriflavin resistance protein family signature	530	548			2698797	961820	2537	0	0	0	1741	0	108
109	DeepTMHMM:outside		outside	535	846			2711943	961820	10025	0	0	0	1741	0	109
110	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	541	846			2698804	961820	3	136:Membrane Protein	0	0	0	1741	0	110
111	SUPERFAMILY:SSF82714	IPR027463	Multidrug efflux transporter AcrB TolC docking domain, DN/DC subdomains	701	784			2698830	961820	5272	0	0	0	1741	0	111
112	SUPERFAMILY:SSF82866		-	781	1002			2698825	961820	12	0	0	0	1741	0	112
113	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	846	867			2698813	961820	5	136:Membrane Protein	0	0	0	1741	0	113
114	DeepTMHMM:TMhelix		TMhelix	847	865			2711944	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	114
115	DeepTMHMM:inside		inside	866	873			2711945	961820	9730	0	0	0	1741	0	115
116	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	867	873			2698809	961820	18	136:Membrane Protein	0	0	0	1741	0	116
117	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	873	894			2698824	961820	5	136:Membrane Protein	0	0	0	1741	0	117
118	DeepTMHMM:TMhelix		TMhelix	874	894			2711946	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	118
119	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	894	899			2698803	961820	3	136:Membrane Protein	0	0	0	1741	0	119
120	DeepTMHMM:outside		outside	895	900			2711947	961820	10025	0	0	0	1741	0	120
121	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	899	925			2698814	961820	5	136:Membrane Protein	0	0	0	1741	0	121
122	DeepTMHMM:TMhelix		TMhelix	901	921			2711948	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	122
123	DeepTMHMM:inside		inside	922	949			2711949	961820	9730	0	0	0	1741	0	123
124	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	925	945			2698806	961820	18	136:Membrane Protein	0	0	0	1741	0	124
125	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	945	965			2698815	961820	5	136:Membrane Protein	0	0	0	1741	0	125
126	DeepTMHMM:TMhelix		TMhelix	950	965			2711950	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	126
127	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	965	970			2698801	961820	3	136:Membrane Protein	0	0	0	1741	0	127
128	DeepTMHMM:outside		outside	966	969			2711951	961820	10025	0	0	0	1741	0	128
129	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	970	1000			2698822	961820	5	136:Membrane Protein	0	0	0	1741	0	129
130	DeepTMHMM:TMhelix		TMhelix	970	993			2711952	961820	2056	141:DeepTMHMM: helix	0	0	0	1741	6	130
131	DeepTMHMM:inside		inside	994	1009			2711953	961820	9730	0	0	0	1741	0	131
132	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	1000	1009			2698807	961820	18	136:Membrane Protein	0	0	0	1741	0	132

↑ Top