Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_031295845.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01013
Genome uid: 230
17280-18545 [+] (421)

Sequence:

KRSSVIIALEICAIAALFVSWSFQRPNSRQVTVGNASEHFIRWVDFDVTADAMTQAFRYDVDTCQQDLHLNWVDLLAYLG
ARYGGDFSHYQASDMTEAAEQLQNGVTVEELTKNMTSFAYYREAYGAVLDGMVGLYEIEIPKSEAPAFALADAQIQEGDP
AANTSYATTPPTTTATTTGTDTIDSASQASPETSASSNTQTSLETPAPTLSDPDAVPLTPSGEEKVWVTKYGLKAFLPLA
KNFPYSHYDDFGVSRSYGYRRRHLGHDMMGQTGTPVIAVESGRVEALGWNQYGGWRIGIRSFDGKRYYYYAHLRKDYPYQ
SNLKEGSLVTAGDVIGYLGHTGYSSTENTNNIAEPHLHFGLQLIFDESQKEGNNEIWIDCYELIRFLAINRSETVKKEGT
KEWTRVYEMKDPSIDQFSTP

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	0	15			2705615	969578	3	136:Membrane Protein	0	0	0	1309	0	1
2	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	0	6			2966177	969578	18	136:Membrane Protein	0	0	0	1309	0	2
3	DeepTMHMM:inside		inside	1	15			2716209	969578	9730	0	0	0	1309	0	3
4	SUPERFAMILY:SSF88946	IPR013325	RNA polymerase sigma factor, region 2	3	101			803468	969578	458	15	0	1	1309	0	4
5	SUPERFAMILY:SSF111283	IPR036059	Metalloprotease TldD/PmbA superfamily	4	446			2759561	969578	4787	0	0	0	1309	0	5
6	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	6	24			2966176	969578	5	136:Membrane Protein	0	0	0	1309	0	6
7	SUPERFAMILY:SSF53383	IPR015424	Pyridoxal phosphate-dependent transferase	11	460			2664766	969578	245	0	0	0	1309	0	7
8	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	15	33			2705624	969578	5	136:Membrane Protein	0	0	0	1309	0	8
9	DeepTMHMM:TMhelix		TMhelix	16	31			2716210	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	9
10	PFAM:PF04542	IPR007627	Sigma-70 region 2	22	90	49	3.8E-13	803464	969578	593	15	0	1	1309	0	10
11	PFAM:PF01523	IPR002510	PmbA/TldA metallopeptidase domain 1	22	86	45.9	5.2E-12	2759560	969578	5465	0	0	0	1309	0	11
12	PFAM:PF00771	IPR001712	FHIPEP family	24	675	918.5	0	2705609	969578	39	0	0	0	1309	0	12
13	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	24	421			2966175	969578	3	136:Membrane Protein	0	0	0	1309	0	13
14	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	31	45			2705605	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	14
15	DeepTMHMM:outside		outside	32	39			2716211	969578	10025	0	0	0	1309	0	15
16	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	33	39			2705610	969578	18	136:Membrane Protein	0	0	0	1309	0	16
17	SUPERFAMILY:SSF54862		-	34	364			2729812	969578	12	0	0	0	1309	0	17
18	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	39	59			2705622	969578	5	136:Membrane Protein	0	0	0	1309	0	18
19	DeepTMHMM:TMhelix		TMhelix	40	55			2716212	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	19
20	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	51	81			2729809	969578	180	0	0	0	1309	0	20
21	PFAM:PF01212	IPR001597	Beta-eliminating lyase	53	427	194.9	0	2664765	969578	5151	0	0	0	1309	0	21
22	DeepTMHMM:inside		inside	56	68			2716213	969578	9730	0	0	0	1309	0	22
23	PFAM:PF00037	IPR017896	4Fe-4S binding domain	59	75	21.7	0.00012	2729808	969578	481	0	0	0	1309	0	23
24	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	59	64			2705619	969578	3	136:Membrane Protein	0	0	0	1309	0	24
25	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	64	82			2705621	969578	5	136:Membrane Protein	0	0	0	1309	0	25
26	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	68	88			2705604	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	26
27	DeepTMHMM:TMhelix		TMhelix	69	84			2716214	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	27
28	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	82	88			2705614	969578	18	136:Membrane Protein	0	0	0	1309	0	28
29	DeepTMHMM:outside		outside	85	113			2716215	969578	10025	0	0	0	1309	0	29
30	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	88	108			2705620	969578	5	136:Membrane Protein	0	0	0	1309	0	30
31	PROSITE_PROFILES:PS51918	IPR007197	Radical SAM core domain profile.	101	336			788949	969578	190	15	0	1	1309	0	31
32	SUPERFAMILY:SSF102114		-	106	304			788951	969578	12	15	0	1	1309	0	32
33	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	108	113			2705618	969578	3	136:Membrane Protein	0	0	0	1309	0	33
34	PFAM:PF04055	IPR007197	Radical SAM superfamily	110	274	41.7	1.5E-10	788948	969578	48	15	0	1	1309	0	34
35	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	113	134			2705628	969578	5	136:Membrane Protein	0	0	0	1309	0	35
36	PFAM:PF19290	IPR045570	PmbA/TldA metallopeptidase central domain	114	219	51.4	1.5E-13	2759559	969578	4786	0	0	0	1309	0	36
37	DeepTMHMM:TMhelix		TMhelix	114	131			2716216	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	37
38	PFAM:PF13394		4Fe-4S single cluster domain	114	219	30.2	4.0E-7	788947	969578	257	15	0	1	1309	0	38
39	CDD:cd01335		Radical_SAM	114	235			788950	969578	258	15	0	1	1309	0	39
40	SUPERFAMILY:SSF88659	IPR013324	RNA polymerase sigma factor, region 3/4-like	117	183			803467	969578	595	15	0	1	1309	0	40
41	CDD:cd06171		Sigma70_r4	124	179			803466	969578	594	15	0	1	1309	0	41
42	PFAM:PF08281	IPR013249	Sigma-70, region 4	125	178	62.4	2.4E-17	803465	969578	592	15	0	1	1309	0	42
43	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	130	147			2705606	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	43
44	DeepTMHMM:inside		inside	132	197			2716217	969578	9730	0	0	0	1309	0	44
45	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	134	197			2705611	969578	18	136:Membrane Protein	0	0	0	1309	0	45
46	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	149	168			2705607	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	46
47	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	179	197			2705603	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	47
48	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	197	219			2705626	969578	5	136:Membrane Protein	0	0	0	1309	0	48
49	DeepTMHMM:TMhelix		TMhelix	198	215			2716218	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	49
50	DeepTMHMM:outside		outside	216	231			2716219	969578	10025	0	0	0	1309	0	50
51	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	219	238			2705617	969578	3	136:Membrane Protein	0	0	0	1309	0	51
52	PFAM:PF19289	IPR045569	PmbA/TldA metallopeptidase C-terminal domain	228	445	224.8	0	2759558	969578	4785	0	0	0	1309	0	52
53	PRINTS:PR00949	IPR001712	Type III secretion system inner membrane A protein family signature	230	245			2705608	969578	36	135:all secretion /signal peptide, lipo	0	0	0	1309	3	53
54	DeepTMHMM:TMhelix		TMhelix	232	252			2716220	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	54
55	SUPERFAMILY:SSF51261	IPR011055	Duplicated hybrid motif	233	362			2966178	969578	1445	0	0	0	1309	0	55
56	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	238	262			2705627	969578	5	136:Membrane Protein	0	0	0	1309	0	56
57	DeepTMHMM:inside		inside	253	279			2716221	969578	9730	0	0	0	1309	0	57
58	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	257	286			2729810	969578	180	0	0	0	1309	0	58
59	PFAM:PF01551	IPR016047	Peptidase family M23	262	363	61.1	9.1E-17	2966174	969578	1443	0	0	0	1309	0	59
60	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	262	273			2705613	969578	18	136:Membrane Protein	0	0	0	1309	0	60
61	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	273	294			2705625	969578	5	136:Membrane Protein	0	0	0	1309	0	61
62	DeepTMHMM:TMhelix		TMhelix	280	294			2716222	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	62
63	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	289	319			2729811	969578	180	0	0	0	1309	0	63
64	PFAM:PF00037	IPR017896	4Fe-4S binding domain	293	315	26.3	4.2E-6	2729807	969578	481	0	0	0	1309	0	64
65	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	294	299			2705616	969578	3	136:Membrane Protein	0	0	0	1309	0	65
66	DeepTMHMM:outside		outside	295	298			2716223	969578	10025	0	0	0	1309	0	66
67	DeepTMHMM:TMhelix		TMhelix	299	314			2716224	969578	2056	141:DeepTMHMM: helix	0	0	0	1309	6	67
68	PHOBIUS:TRANSMEMBRANE		Region of a membrane-bound protein predicted to be embedded in the membrane.	299	315			2705623	969578	5	136:Membrane Protein	0	0	0	1309	0	68
69	DeepTMHMM:inside		inside	315	686			2716225	969578	9730	0	0	0	1309	0	69
70	PHOBIUS:CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.	315	686			2705612	969578	18	136:Membrane Protein	0	0	0	1309	0	70

↑ Top