Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_032475255.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: PROKKA_01822
Genome uid: 234
134658-135539 [+] (293)

Sequence:

KMEDMKLIKVIASDMDGTLLNSQHDITEENVKAILKSKELGIHFIIATGRMYDSVKPFMDKYGIKCEYILMNGAEFRDEN
GEIVESISMNKGKIKDILDILRKENLIVELYTGDGSYTINTKEEALKEMVYRVQNFEKVQDYDKALEIAKNHDHFKSLKY
IDDIDKFIESDIEVRKIITFSNDIEIIKRTKSELSDIGGLAVLSSFITNIEITDERAQKGYILKKVTEKMGVKNEEVIAF
GDSFNDYSLFTEFKKAYAMENAIPEIKEIAKNITDTNDNSGVAKAIYKELGI

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PHOBIUS:SIGNAL_PEPTIDE_N_REGION		N-terminal region of a signal peptide.	0	2			949860	991223	21	135:all secretion /signal peptide, lipo	5	0	1	2478	3	1
2	PHOBIUS:SIGNAL_PEPTIDE		Signal peptide region	0	19			949861	991223	19	135:all secretion /signal peptide, lipo	5	0	1	2478	3	2
3	SUPERFAMILY:SSF82771	IPR035901	GIY-YIG endonuclease superfamily	0	71			2728004	991223	2876	0	0	0	2478	0	3
4	PROSITE_PROFILES:PS51118	IPR002577	HxlR-type HTH domain profile.	0	60			1946251	991223	4631	5	0	1	2478	0	4
5	PROSITE_PROFILES:PS50164	IPR000305	GIY-YIG domain profile.	0	75			2728002	991223	2873	0	0	0	2478	0	5
6	PROSITE_PROFILES:PS50112	IPR000014	PAS repeat profile.	0	51			2101318	991223	281	5	0	1	2478	0	6
7	SUPERFAMILY:SSF46785	IPR036390	Winged helix DNA-binding domain superfamily	1	56			1946252	991223	42	5	0	1	2478	0	7
8	SMART:SM00091	IPR000014		1	70			2101312	991223	1	5	0	1	2478	0	8
9	PFAM:PF01541	IPR000305	GIY-YIG catalytic domain	1	73	60.2	1.7E-16	2728001	991223	2872	0	0	0	2478	0	9
10	PHOBIUS:SIGNAL_PEPTIDE_H_REGION		Hydrophobic region of a signal peptide.	2	14			949862	991223	24	135:all secretion /signal peptide, lipo	5	0	1	2478	3	10
11	PFAM:PF01638	IPR002577	HxlR-like helix-turn-helix	2	57	49.6	2.6E-13	1946250	991223	4630	5	0	1	2478	0	11
12	CDD:cd10456		GIY-YIG_UPF0213	2	65			2728003	991223	6039	0	0	0	2478	0	12
13	SUPERFAMILY:SSF56784	IPR036412	HAD-like superfamily	3	290			3204312	991223	469	0	0	0	2478	0	13
14	SUPERFAMILY:SSF55785	IPR035965	PAS domain superfamily	3	102			2101322	991223	289	5	0	1	2478	0	14
15	SMART:SM00899	IPR007167		4	77			2701862	991223	1	0	0	0	2478	0	15
16	PFAM:PF04023	IPR007167	FeoA domain	5	76	64.7	6.3E-18	2701863	991223	620	0	0	0	2478	0	16
17	SUPERFAMILY:SSF50037	IPR008988	Transcriptional repressor, C-terminal	6	76			2701864	991223	621	0	0	0	2478	0	17
18	CDD:cd07516		HAD_Pase	10	289			3204311	991223	3673	0	0	0	2478	0	18
19	CDD:cd00130	IPR000014	PAS	10	107			2101320	991223	285	5	0	1	2478	0	19
20	PFAM:PF08282		haloacid dehalogenase-like hydrolase	11	287	203.9	0	3204310	991223	468	0	0	0	2478	0	20
21	PFAM:PF13426	IPR000014	PAS domain	12	109	45.2	9.4E-12	2101315	991223	275	5	0	1	2478	0	21
22	SUPERFAMILY:SSF53613	IPR029056	Ribokinase-like	13	301			2679030	991223	819	0	0	0	2478	0	22
23	PHOBIUS:SIGNAL_PEPTIDE_C_REGION		C-terminal region of a signal peptide.	14	19			949863	991223	26	135:all secretion /signal peptide, lipo	5	0	1	2478	3	23
24	PHOBIUS:NON_CYTOPLASMIC_DOMAIN		Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.	19	77			949859	991223	3	136:Membrane Protein	5	0	1	2478	0	24
25	SUPERFAMILY:SSF53244	IPR036615	Mur ligase, C-terminal domain superfamily	31	177			2876359	991223	65	0	0	0	2478	0	25
26	PFAM:PF00294	IPR011611	pfkB family carbohydrate kinase	34	296	134.6	4.3E-39	2679029	991223	817	0	0	0	2478	0	26
27	SUPERFAMILY:SSF110581	IPR022830	Indigoidine synthase A-like	36	265			2768839	991223	9729	0	0	0	2478	0	27
28	PFAM:PF04227	IPR007342	Indigoidine synthase A like protein	39	264	64	1.3E-17	2768838	991223	9728	0	0	0	2478	0	28
29	PROSITE_PROFILES:PS50113	IPR000700	PAC domain profile.	66	119			2101317	991223	280	5	0	1	2478	0	29
30	SUPERFAMILY:SSF52540	IPR027417	P-loop containing nucleoside triphosphate hydrolase	142	386			2101321	991223	78	5	0	1	2478	0	30
31	PFAM:PF00158	IPR002078	Sigma-54 interaction domain	143	311	235.1	0	2101314	991223	3751	5	0	1	2478	0	31
32	PROSITE_PROFILES:PS50045	IPR002078	Sigma-54 interaction domain profile.	143	373			2101316	991223	2700	5	0	1	2478	0	32
33	SMART:SM00382	IPR003593		163	308			2101311	991223	1	5	0	1	2478	0	33
34	CDD:cd00009		AAA	167	315			2101319	991223	93	5	0	1	2478	0	34
35	SUPERFAMILY:SSF46689	IPR009057	Homeobox-like domain superfamily	399	451			2101323	991223	657	5	0	1	2478	0	35
36	PFAM:PF18024	IPR030828	Helix-turn-helix domain	405	451	36.3	3.3E-9	2101313	991223	1014	5	0	1	2478	0	36

↑ Top