Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

GCF_032473275.1: Clostridium sp., na [+] (ncbi)

Genbanks info:

Genbank_acc: WP_316121290.1:PROKKA_02497
Genome uid: 236
7672-9399 [+] (575)

Sequence:

KNITINGNKILVDDNKNLMKIAKENGIDIPALCFLEDCSNVGQCGVCLVEVEGQEDLVKACCFIPEDGMVINTNTERVQE
EVKSTVSSLLDKHEFKCGPCKRRENCEFLKLVIKTKARASKPFVVADKSEYVDDRSKSIVLDRTKCVTCGRCVAACKTKT
GTESIKFIEVDGQKIVGPENLKCFDDTNCLLCGQCVAACPVDALSEKSHMDRVKDALADQEKHVIVAMAPSVRTAMGELF
KMGYGVDVTGKVYTALRELGFDKIFDINFGADMTIMEEATELIQRIKTGGPFPMFTSCCPAWVRQVENYYPNFIEHLSSA
KSPQQIFGTASKTYYPQVADVDPKNVFTVTIMPCTAKKYEADRPEMENDGIRNIDAVITTRELAKMIKDAKIDFAKLEDS
EADPAMGEYTGAGAIFGATGGVMEAALRTAKDFVEGKDLENIEYEQVRGLAGIKEATVEIGGDNYNVAVINGASSLFEFM
KSGKVNEKKYHFIEVMACPGGCVNGGGQPHVNASDRLTMDIRSVRASVLYNQDKNVLKKRKSHENGALNKMYETFMGEPG
HGKAHELLHIKYSK

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	SUPERFAMILY:SSF54292	IPR036010	2Fe-2S ferredoxin-like superfamily	0	122			3326616	997258	580	0	0	0	323	0	1
2	PROSITE_PROFILES:PS51085	IPR001041	2Fe-2S ferredoxin-type iron-sulfur binding domain profile.	1	78			3326611	997258	578	0	0	0	323	0	2
3	PFAM:PF13510		2Fe-2S iron-sulfur cluster binding domain	2	76	49.7	2.9E-13	3326605	997258	577	0	0	0	323	0	3
4	CDD:cd00207	IPR001041	fer2	3	72			3326613	997258	579	0	0	0	323	0	4
5	PROSITE_PROFILES:PS51839	IPR019574	His(Cys)3-ligated-type [4Fe-4S] domain profile.	77	117			3326612	997258	949	0	0	0	323	0	5
6	SUPERFAMILY:SSF54862		-	132	207			3326614	997258	12	0	0	0	323	0	6
7	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	137	167			3326609	997258	180	0	0	0	323	0	7
8	PFAM:PF12838	IPR017896	4Fe-4S dicluster domain	145	204	28.4	1.8E-6	3326606	997258	175	0	0	0	323	0	8
9	PROSITE_PROFILES:PS51379	IPR017896	4Fe-4S ferredoxin-type iron-sulfur binding domain profile.	179	210			3326610	997258	180	0	0	0	323	0	9
10	SUPERFAMILY:SSF53920	IPR009016	Iron hydrogenase	188	573			3326615	997258	950	0	0	0	323	0	10
11	PFAM:PF02906	IPR004108	Iron only hydrogenase large subunit, C-terminal domain	222	507	317.2	0	3326607	997258	946	0	0	0	323	0	11
12	SMART:SM00902	IPR003149		516	575			3326604	997258	1	0	0	0	323	0	12
13	PFAM:PF02256	IPR003149	Iron hydrogenase small subunit	520	574	66.8	1.3E-18	3326608	997258	943	0	0	0	323	0	13

↑ Top