We will take the links to it out when ready.
GCF_032473275.1: Clostridium sp., na [+] (ncbi)
CKKTYYITTPIYYPSTKLHIGNTYTTVAADALARYKRLTGYDVMFLTGTDEHGQKIQRIAEEKGITPKEHVDEIVSGIKD LWKMMNISYDKFIRTTDDYHIKAVQDIFKKLYDKGDIYKSSYEGLYCTPCESFWTETQLVNGNCPDCGRPVEKSKEEAYF FKMSNYADKLMEYIETHPDFIQPESRKNEMVNNFLKPGLQDLCVSRTSFNWGVPVTFDENHVVYVWIDALSNYITALGYG SDNKDLYDKYWPADVHLIGKDILRFHTIYWPIMLMALDLPLPKQVFGHGWLLVDGGKMSKSKGNVVDPVTLVENFGVDAV RYYLLREIPFGSDGLFNNEIFIKKINSDLCNDLGNLLSRTVAMIEKYFDGVIPNNNVKEAIDDELISLALETPKKVNKAI DDLRIPEALENIFELIGRANKYIDETTPWILAKDEDKKERLGTVLYNLIESLRFSSVLLSAFLPDTSKKINEQINASNIT FESLNDFNGTIVGTKVQKGEALFPRIDVDKKIAELEALREAQLAANKKEEKREITPIKEEITIEDFEKIDLRVVKVLECE PIKKAKKLLKLKVDLNGEERQVVSGIAQYYKPEDLVGKYVVLVANLKPVTLRGELSQGMILAASTDDDSLLKVVNPGELP TGSVVR
| extraction_method | ipr_acc | domain | start | end | score | evalue | rowid | gbid | domain_id | mod_id | cat_id | redundant | used | ord | mod_group | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | SUPERFAMILY:SSF52374 | - | 2 | 348 | 3323494 | 999043 | 12 | 0 | 0 | 0 | 2108 | 0 | 1 | ||||
| 2 | PFAM:PF00133 | IPR002300 | tRNA synthetases class I (I, L, M and V) | 2 | 134 | 44.8 | 5.3E-12 | 3323488 | 999043 | 720 | 0 | 0 | 0 | 2108 | 0 | 2 | |
| 3 | CDD:cd00814 | IPR033911 | MetRS_core | 4 | 337 | 3323491 | 999043 | 1805 | 0 | 0 | 0 | 2108 | 0 | 3 | |||
| 4 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 7 | 21 | 3323483 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 4 | |||
| 5 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 39 | 54 | 3323479 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 5 | |||
| 6 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 87 | 99 | 3323482 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 6 | |||
| 7 | PFAM:PF09334 | IPR015413 | tRNA synthetases class I (M) | 148 | 361 | 229.9 | 0 | 3323486 | 999043 | 1798 | 0 | 0 | 0 | 2108 | 0 | 7 | |
| 8 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 223 | 235 | 3323481 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 8 | |||
| 9 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 256 | 272 | 3323484 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 9 | |||
| 10 | CDD:cd07957 | IPR041872 | Anticodon_Ia_Met | 345 | 475 | 3323492 | 999043 | 1807 | 0 | 0 | 0 | 2108 | 0 | 10 | |||
| 11 | PRINTS:PR01041 | IPR033911 | Methionyl-tRNA synthetase signature | 348 | 360 | 3323480 | 999043 | 1797 | 0 | 0 | 0 | 2108 | 0 | 11 | |||
| 12 | SUPERFAMILY:SSF47323 | IPR009080 | Aminoacyl-tRNA synthetase, class Ia, anticodon-binding | 350 | 560 | 3323493 | 999043 | 726 | 0 | 0 | 0 | 2108 | 0 | 12 | |||
| 13 | PFAM:PF08264 | IPR013155 | Anticodon-binding domain of tRNA ligase | 384 | 540 | 30.4 | 3.3E-7 | 3323487 | 999043 | 722 | 0 | 0 | 0 | 2108 | 0 | 13 | |
| 14 | CDD:cd02800 | IPR004495 | tRNA_bind_EcMetRS_like | 541 | 647 | 3323490 | 999043 | 1810 | 0 | 0 | 0 | 2108 | 0 | 14 | |||
| 15 | SUPERFAMILY:SSF50249 | IPR012340 | Nucleic acid-binding, OB-fold | 544 | 644 | 3323495 | 999043 | 405 | 0 | 0 | 0 | 2108 | 0 | 15 | |||
| 16 | PROSITE_PROFILES:PS50886 | IPR002547 | tRNA-binding domain profile. | 545 | 647 | 3323489 | 999043 | 1804 | 0 | 0 | 0 | 2108 | 0 | 16 | |||
| 17 | PFAM:PF01588 | IPR002547 | Putative tRNA binding domain | 551 | 643 | 92.3 | 1.5E-26 | 3323485 | 999043 | 1799 | 0 | 0 | 0 | 2108 | 0 | 17 |