Cellulosome Database Search

This page is just for checking and is not meant to be part of the public site.

We will take the links to it out when ready.

Genome ifo

Gs0120309: Syntrophomonas wolfei (Swol), Goettingen.DSM2245B [+] (IMG)

Genbanks info:

Genbank_acc: Ga0065332_11343:Swol_00331
Genome uid: 409
386055-386786 [+] (243)

Sequence:

TITPNEYRPVPTEVIKKQKAFFQSGASWELAFRMQQLRQLERAIDKWENELLRALELDLGKCRQEAYMTEVGLLRAELAH
IMKNLPSWVQTRKVRTPCLYPGARSLIYPEPLGQVLIISPWNYPVYLALTPLLGAMAAGNCTVIKPSELAPHSSAVLQAL
IQDSFPEEYIAVFEGGAEMSSELLEQPFDHIFFTGGSTVGKLVMQAAARQLYADDPGIGREKSLPGGSGYQYRVHRPPYY
LG

	extraction_method	ipr_acc	domain	start	end	score	evalue	rowid	gbid	domain_id	mod_id	cat_id	redundant	used	ord	mod_group
1	PFAM:PF00171	IPR015590	Aldehyde dehydrogenase family	14	212	118.2	3.3E-34	5018885	1779423	686	0	0	0	319	0	1
2	SUPERFAMILY:SSF53720	IPR016161	Aldehyde/histidinol dehydrogenase	14	212			5018886	1779423	688	0	0	0	319	0	2

↑ Top